Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= BRENDA::P68187 (371 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 157 bits (398), Expect = 3e-43 Identities = 91/228 (39%), Positives = 136/228 (59%), Gaps = 12/228 (5%) Query: 1 MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 60 M ++ LQ KA G + DI L I +GEF+ GPSG GK++ LRMI+GL T G L Sbjct: 1 MINIDLQKSLKANGPAM-DLDIKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHL 59 Query: 61 FIGEKRMNDTP------PAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRV 114 + ++ D P R +G +FQ Y+L+P+++V EN++F LK A K ++ Sbjct: 60 SVNGEQWFDASFGKNVSPGRRKLGYLFQDYSLFPNMTVKENIAFALKNAKDKAYLM---- 115 Query: 115 NQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRI 174 ++ E + L HL D PK LSGGQ+QRVA+ R L +P + LLDEPLS LD ++R +++ Sbjct: 116 -ELLESMGLLHLQDTLPKHLSGGQQQRVALARALALKPDILLLDEPLSALDPSMREKLQE 174 Query: 175 EISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY 222 I +H++ T I V+HD E + L+D+I+ LD G+V + P E + Sbjct: 175 YILAIHRKYALTTILVSHDAGEIIKLSDRIIELDHGKVLRQCTPKEFF 222 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 290 Length adjustment: 28 Effective length of query: 343 Effective length of database: 262 Effective search space: 89866 Effective search space used: 89866 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory