Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Echvi_1022 Echvi_1022 ABC-type spermidine/putrescine transport systems, ATPase components
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__Cola:Echvi_1022 Length = 345 Score = 145 bits (365), Expect = 2e-39 Identities = 83/244 (34%), Positives = 134/244 (54%), Gaps = 13/244 (5%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 M+ + L I K +P + VKD +++I++ VG +G GKTT L++IAGLE +G Sbjct: 1 MSLLQLHGISKKFPQTKQFAVKDIHMEIEEGSVQAIVGENGSGKTTLLKLIAGLEHPDKG 60 Query: 61 NL-YIGDRRVND---VPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRV 116 + + G VN +P R++ ++FQ YAL+P MT+ +N+ R+ E Sbjct: 61 EIVFSGQTIVNGKSALPANQREVGVIFQEYALFPQMTLLENV------REALHQESRNAR 114 Query: 117 QEAAKILDIAHLLDR---KPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQ 173 Q A L +A L D P LS GQRQR AL RA+ P++ L+D+P +LD + + + Sbjct: 115 QIAMDSLALAGLEDSFSAYPHQLSSGQRQRAALARALASRPKLLLLDDPFRSLDTRFKNE 174 Query: 174 MRAEIRKLHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVA 233 + +IR + + T I +H +A+++ D I ++ G++QQ TP +Y +P N +VA Sbjct: 175 ISEDIRDIVKATGITAIVASHHAKDALSLADSIAILHKGILQQVGTPVEIYKKPANAYVA 234 Query: 234 GFIG 237 F G Sbjct: 235 NFFG 238 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 345 Length adjustment: 29 Effective length of query: 355 Effective length of database: 316 Effective search space: 112180 Effective search space used: 112180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory