Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate Echvi_4044 Echvi_4044 ABC-type transport system involved in resistance to organic solvents, ATPase component
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__Cola:Echvi_4044 Length = 249 Score = 157 bits (397), Expect = 3e-43 Identities = 87/237 (36%), Positives = 136/237 (57%), Gaps = 7/237 (2%) Query: 4 IQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTISID 63 ++ +KKSFG DVL G+DLD+ GE +V++G SG GKS L++ + GL + D GT+++ Sbjct: 6 VEVRGLKKSFGELDVLMGVDLDLYKGENVVVLGKSGTGKSVLIKIMVGLLTQDEGTMNVL 65 Query: 64 GKKIN-----DIEPQNRDIAMVFQSYALYPHMTVAENMGFGL--KLKNLAAAEITKRVNE 116 GK+++ D+ I FQ+ ALY MTV EN+ F L +K L+ E K V E Sbjct: 66 GKEVSNLGAKDLNELRLKIGFSFQASALYDSMTVRENLEFPLVRNVKGLSRTEKDKMVEE 125 Query: 117 ISELLQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEI 176 + E + + +++ P ELSGGQR+R+ + R L + ++L+DEP + LD S + I Sbjct: 126 VLEAVGLSQTINQMPSELSGGQRKRIGIARTLILKPEIMLYDEPTAGLDPITCSDINNLI 185 Query: 177 KRLHHNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATF 233 + N ++ I +THD A GDR+AVL DG G E++ P++ + +F Sbjct: 186 NEVRENYNTSSIIITHDLTCARDTGDRVAVLLDGQFGAEGKFEEVFKTPEDQRVKSF 242 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 249 Length adjustment: 26 Effective length of query: 321 Effective length of database: 223 Effective search space: 71583 Effective search space used: 71583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory