Align Mannokinase (EC 2.7.1.7) (characterized)
to candidate Echvi_3894 Echvi_3894 Transcriptional regulator/sugar kinase
Query= reanno::Smeli:SMc03109 (298 letters) >FitnessBrowser__Cola:Echvi_3894 Length = 291 Score = 72.4 bits (176), Expect = 1e-17 Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 5/161 (3%) Query: 1 MFIGIDWGGTKMEVIALDRDGETRARHRVPTPTSGYEDCIRAVV-ELVASAESTAGERGS 59 + +G+D GGT + + +DGE + +PTP+ ++ I + + + +AS S E Sbjct: 6 LILGLDIGGTSINA-GIMKDGELIEKREIPTPSQEPQEVILSTIADFIASYFSH--EIDG 62 Query: 60 IGIGIPGSPNPRTGIVRN-SNAVLINGKPLGRDLAAALGREVRLANDANCLAVSEAVDGA 118 IGIGIPG + GIV N N N L L L + V + NDANC A+ E G Sbjct: 63 IGIGIPGLVDAEKGIVYNLENIPAFNKVALKDYLERTLEKPVYINNDANCFALGEYKFGG 122 Query: 119 GKDAGVVFGVIVGTGHGGGLAIGKKVHAGYQGVAAEIGHYP 159 + G+ +GTG G G+ +++ G+ A E G P Sbjct: 123 ANKHRHMVGITLGTGIGTGVITNGELYPGFLCGAGEWGGVP 163 Lambda K H 0.319 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 291 Length adjustment: 26 Effective length of query: 272 Effective length of database: 265 Effective search space: 72080 Effective search space used: 72080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory