Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate Echvi_2940 Echvi_2940 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= SwissProt::O93868 (262 letters) >FitnessBrowser__Cola:Echvi_2940 Length = 251 Score = 134 bits (337), Expect = 2e-36 Identities = 89/256 (34%), Positives = 138/256 (53%), Gaps = 21/256 (8%) Query: 11 NKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAYQCDV 70 NKTI++TGG GIGLA T+ A G NV I K +V E++ + G + Q DV Sbjct: 3 NKTILITGGASGIGLAMTKRFAEEGGNVYFIDYDQKTGEKVAEELTSK-GHRVTFLQGDV 61 Query: 71 SNTDIVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRA 130 S T+ + +TI I G+I L+ NAG+S V EDF +Y VNV G++N + Sbjct: 62 SQTEEMKQTISSIS---GSIDVLVNNAGISHVGNLENTAEEDFDRLYQVNVKGIYNC--S 116 Query: 131 VAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASA 190 +A L K++ GSI+ +S++S + G + Y+ +K A ++ +A ++ Sbjct: 117 LASLPKMKEKGGSIINMASVASTM-------GLPDRFAYSMTKGAVFSMTLSMARDYVEY 169 Query: 191 GIRVNALSPGYVNTD--------QTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLS 242 IRVN+++PG V+T +K++ D A+ P+ R +PEE+ A+ L S Sbjct: 170 NIRVNSIAPGRVHTPFVDGFLAKNYPGKEKEMFDKLAATQPIGRMGKPEEIAAMAVYLSS 229 Query: 243 DHATYMTGGEYFIDGG 258 D A+++TGG Y IDGG Sbjct: 230 DEASFLTGGNYPIDGG 245 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 251 Length adjustment: 24 Effective length of query: 238 Effective length of database: 227 Effective search space: 54026 Effective search space used: 54026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory