Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate Echvi_1280 Echvi_1280 Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Cola:Echvi_1280 Length = 318 Score = 237 bits (605), Expect = 3e-67 Identities = 134/312 (42%), Positives = 190/312 (60%), Gaps = 16/312 (5%) Query: 40 VLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGSV 99 ++ L+ L L L D F + N N++RQV++N+ ++ GMT VILTAGIDLSVGS+ Sbjct: 10 LIALIILCLVLSLLSD---RFLTLANGWNVMRQVSVNICISVGMTLVILTAGIDLSVGSI 66 Query: 100 LAVS------------AVLGMQVSLGAAPGWAIPMFIFSGLVMGMVNGAMVALLNINAFV 147 LA+ AV G+ + +G AP A+ + + G +G NG + + FV Sbjct: 67 LALCGAVTASLIKNGIAVEGLNLHIGFAPLGAVILGVGLGFGLGWFNGWTITRFKVPPFV 126 Query: 148 VTLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILR 207 TL +T RG L G + N F ++G G FL +P +W+ +V L+ ++ + Sbjct: 127 ATLAMLTIARGLTMLWTGGFPI-NGLGEDFAFLGTGWFLGIPMPVWITAVIVALAVLLTK 185 Query: 208 KTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGS 267 KT G ++YAIGGN +AARL+GI + V + VY+I+G + + G + SRL A N G Sbjct: 186 KTKFGRYVYAIGGNERAARLSGINISRVKMTVYAIAGGLAAVGGMIVTSRLDSAQPNAGI 245 Query: 268 GYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIV 327 YELDAIAAVV+GGTSL GG G+I G V+G +IIGV+NNGL +L +S FWQ V KGAVI+ Sbjct: 246 SYELDAIAAVVIGGTSLSGGKGTIMGAVLGGIIIGVLNNGLVLLNVSPFWQQVVKGAVIL 305 Query: 328 LAVILDKWRQKD 339 LAV++DK K+ Sbjct: 306 LAVVIDKANSKE 317 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 318 Length adjustment: 28 Effective length of query: 316 Effective length of database: 290 Effective search space: 91640 Effective search space used: 91640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory