Align mannose-1-phosphate guanylyltransferase (EC 2.7.7.13); glucose-1-phosphate guanylyltransferase (EC 2.7.7.34); aldose-1-phosphate nucleotidyltransferase (EC 2.7.7.37); mannose-6-phosphate isomerase (EC 5.3.1.8) (characterized)
to candidate Echvi_4408 Echvi_4408 Mannose-1-phosphate guanylyltransferase
Query= BRENDA::O58649 (464 letters) >FitnessBrowser__Cola:Echvi_4408 Length = 332 Score = 215 bits (548), Expect = 2e-60 Identities = 129/357 (36%), Positives = 210/357 (58%), Gaps = 45/357 (12%) Query: 4 LILAGGKGTRLWPLSREAMPKQFIKVFSDRSLFQKTVERALIFSKP--KEIFVVTNKEYR 61 ++L+GG G+RLWPLSR++ PKQ++ +F +R+LFQKTVER ++P ++ +V N+ Sbjct: 6 VVLSGGVGSRLWPLSRKSCPKQYLPIFEERTLFQKTVER----NQPLCDQLMIVGNQANY 61 Query: 62 FRVLDDLNELGLKVPEENILLEPVGKNTLPAIYWGLKVINDNYGDSVVAVLPSDHAIEVN 121 D+ LG+ E ++E +NT AI + + ++ V PSDH I Sbjct: 62 ELSRKDIKGLGITKYIE--VIEACPRNTAAAIAFAAFRSGP---EDILFVTPSDHLITTG 116 Query: 122 ESYMEAFKKAEKLA-EKYLVTFGIKPTKPHTGYGYIKPGEKIEVEGKVLGYLVDEFKEKP 180 ++Y ++ ++A +LA E ++VTFG+KPT+P TG+GYI+ G V F+EKP Sbjct: 117 DAYTKSVERAIELAKEDHIVTFGLKPTRPETGFGYIEAD----------GESVKGFREKP 166 Query: 181 DLETARKYVENG-YYWNSGMFMFKVSVFMEEARKHSPDVVKAFEEGKSI-------EEIY 232 DL TA +++E G + WNSGMF FK VF+ E + P+V K +E +E+ Sbjct: 167 DLATAEQFLEQGNFLWNSGMFCFKAQVFLSELESYEPEVFKRSQEAMEAASDGFLDKELS 226 Query: 233 ELAPEISVDYGIMEKTNKAAVVPLNTYWNDLGSFDAVYEALEKDENGNAVHVTGFKAKYI 292 P ISVDY +ME+T K VVP + W+D+GSF++V+E +E+ G++ Sbjct: 227 MKIPSISVDYAVMERTRKIKVVPSSFGWSDMGSFESVFEYMEQH---------GYEP--- 274 Query: 293 NVDSRNNLVLTERL-TATVGVEDLVIIDTGDALLVAKRGETQKVKEVYKKLKEENDE 348 D++ N+++ + T VG+E+ +++ T DA+LV K+ Q VK+V++KL+++ E Sbjct: 275 --DAQGNMIIGSNVHTEFVGLENTILVQTKDAILVLKKESAQDVKKVFEKLEKDKPE 329 Lambda K H 0.316 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 19 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 332 Length adjustment: 31 Effective length of query: 433 Effective length of database: 301 Effective search space: 130333 Effective search space used: 130333 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory