Align Inositol transport system ATP-binding protein (characterized)
to candidate Echvi_3112 Echvi_3112 ABC-type hemin transport system, ATPase component
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Cola:Echvi_3112 Length = 271 Score = 87.4 bits (215), Expect = 3e-22 Identities = 66/209 (31%), Positives = 106/209 (50%), Gaps = 16/209 (7%) Query: 26 VSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPRDAIAAGIA 85 V + ++PGE +LG NGAGKST +K +SG + G I L PR +A A Sbjct: 21 VDLQIYPGEVLTILGPNGAGKSTLLKLLSGENTCDTGKISINQVLLQQLKPRQ-LAKYRA 79 Query: 86 TVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRKMGINLRGPDQA 145 + QH ++ NF E I +G L H ++++ MEE+ + ++ Sbjct: 80 VMPQHSSV--------NFPYTVEEIIALGKLAHDPHSSSDQL-MEEVMDITGTAALRERM 130 Query: 146 VGTLSGGERQTVAIARAV------HFGAKVLILDEPTSALGVRQTANVLATIDKVRKQGV 199 + LSGGERQ V +ARA+ A+ L+LDEPTS++ + Q VL + +R++ + Sbjct: 131 IKGLSGGERQRVHLARALLQIWEDKPYARYLLLDEPTSSMDIAQQHQVLRLLRFLRQRNI 190 Query: 200 AVVFITHNVRHALAVGDRFTVLNRGKTLG 228 V+ I H++ A D+ ++ GK +G Sbjct: 191 GVLTILHDLNLAAQYSDKVMLMKDGKVVG 219 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 271 Length adjustment: 25 Effective length of query: 236 Effective length of database: 246 Effective search space: 58056 Effective search space used: 58056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory