Align Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase; EC 1.1.1.18; EC 1.1.1.369; Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase; MI 2-dehydrogenase/DCI 3-dehydrogenase (uncharacterized)
to candidate Echvi_3375 Echvi_3375 Predicted dehydrogenases and related proteins
Query= curated2:Q88S38 (350 letters) >FitnessBrowser__Cola:Echvi_3375 Length = 382 Score = 81.3 bits (199), Expect = 4e-20 Identities = 71/232 (30%), Positives = 108/232 (46%), Gaps = 27/232 (11%) Query: 8 KVGIVGIGFIGSDHLHRLTKTVANVDVTAVCDIVPGKAQKALDQQGLT-ATTYEDYHDLV 66 K IVG GFIG HL L + + N++V A+C++ A++ G+ A T+E+ ++ Sbjct: 6 KAAIVGTGFIGPAHLEALRR-IPNIEVIALCEVNQELAEEKAKLLGIPQAFTFEE---ML 61 Query: 67 NDPNVEVVVCTANNEAHYEIVMAALKAGKFTFCEKPLA--LDAKQCMDIIDSEKKLGRRM 124 P +EVV N HY AAL+AGK CEKPLA +D + + + EK L + Sbjct: 62 KQPEIEVVHICTPNFLHYNQSKAALEAGKHVVCEKPLATKIDEAEALVALAKEKGL---V 118 Query: 125 LQVGFMRHYAPEYVQMKKMIDDGVIGK------PLMMDQRHYN-----QTQPEEYDSSRS 173 V F Y P QMK M ++G +G + D + N + +P++ SR+ Sbjct: 119 NAVHFNLRYYPMVRQMKTMRENGELGDIYSIMGSYLQDWLYLNTDYNWRLEPDKSGDSRA 178 Query: 174 IIETAIHEIDIDHWLVNDDYANIRVFSPKQTRHVQNAKIQDPQIVMIETKSG 225 I + H +D+ ++ V + T H K P IET SG Sbjct: 179 IADIGSHLLDLTEYVTG--LKITEVMADFSTVHKTRLKPLKP----IETYSG 224 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 382 Length adjustment: 30 Effective length of query: 320 Effective length of database: 352 Effective search space: 112640 Effective search space used: 112640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory