Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate Echvi_0069 Echvi_0069 Enoyl-CoA hydratase/carnithine racemase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >FitnessBrowser__Cola:Echvi_0069 Length = 260 Score = 118 bits (296), Expect = 1e-31 Identities = 81/261 (31%), Positives = 131/261 (50%), Gaps = 9/261 (3%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGSEKA 60 M Y+ I + ++RP NALN +++EL AA + + + +V+TG A Sbjct: 1 MDYKYIRSSVNNHCQEIAIDRPAVFNALNFEVLEELKAAFDQAAQAETVRCVVLTGGGGA 60 Query: 61 FAAGADIGMMSTYTYMDVYKGDYITRNWET-----VRSIRKPIIAAVAGFALGGGCELAM 115 F +G D+ + T +D I R + +R++ KPII + G A+G GC LA+ Sbjct: 61 FCSGQDLKAVGTD--LDGIPFKEIIRKYYNPLIIQMRNLSKPIICKLNGAAVGAGCSLAL 118 Query: 116 MCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAG 175 D+I A+ A + +G++ AG LP+ V A +L T R + A EAER G Sbjct: 119 ATDVIIASKEAYLAEMFAHIGLVMDAGSNYFLPKRVGYPLAFELATTGRKVYAEEAERLG 178 Query: 176 LVSRVIPAASLVDEAIAAAATI-AEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSL 234 LV++ I ++L DE +A + A+ M+KE + ++ +L E + E Sbjct: 179 LVNKAIEHSAL-DETVAQYVEVYVNASGSAIGMIKEMLRKSNGMSLEEVLEMEAVYQEKA 237 Query: 235 FATEDQKEGMAAFVEKRKPVF 255 + +D KEG+ +F+EKRKP F Sbjct: 238 GSHQDFKEGVTSFLEKRKPRF 258 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory