Align 3-hydroxybutyryl-CoA dehydrogenase subunit (EC 1.1.1.35) (characterized)
to candidate Echvi_3304 Echvi_3304 3-hydroxyacyl-CoA dehydrogenase
Query= metacyc::MONOMER-11936 (282 letters) >FitnessBrowser__Cola:Echvi_3304 Length = 287 Score = 265 bits (676), Expect = 1e-75 Identities = 142/272 (52%), Positives = 187/272 (68%), Gaps = 1/272 (0%) Query: 12 MGAGIVQAFAQKGCEVIVRDIKEEFVDRGIAGITKGLEKQVAKGKMSEEDKEAILSRISG 71 MG GI FAQ +V + D E+ +++G+A I K L++Q+ KG + E K++ L+ I+ Sbjct: 1 MGNGIAHVFAQHDHQVSLIDKDEKALEKGLATIAKNLDRQIEKGIIQAETKDSTLANITP 60 Query: 72 TTDM-KLAADCDLVVEAAIENMKIKKEIFAELDGICKPEAILASNTSSLSITEVASATKR 130 +DM K + +VVEAA EN ++K EIF +LD EAILA+NTSS+SIT++A+AT R Sbjct: 61 YSDMEKGVKNVAIVVEAATENTELKLEIFRQLDQFSPKEAILATNTSSISITKIAAATSR 120 Query: 131 PDKVIGMHFFNPAPVMKLVEIIKGIATSQETFDAVKELSVAIGKEPVEVAEAPGFVVNGI 190 PDKVIGMHF NP PVM+LVE+IKG TS+ET V ++ A+ K PV V + PGFV N I Sbjct: 121 PDKVIGMHFMNPVPVMQLVEVIKGYKTSEETTHQVMSVAKALEKAPVAVNDYPGFVANRI 180 Query: 191 LIPMINEASFILQEGIASVEDIDTAMKYGANHPMGPLALGDLIGLDVCLAIMDVLFTETG 250 L+PMINEA + L EG++ V++IDT MK G HPMGPL L D IGLDVC AI+DVL+ G Sbjct: 181 LMPMINEAIYALYEGVSGVQEIDTVMKLGMAHPMGPLQLADFIGLDVCHAILDVLYQGLG 240 Query: 251 DNKYRASSILRKYVRAGWLGRKSGKGFYDYSK 282 + KY +L V AG G KSG+GFY YS+ Sbjct: 241 NPKYAPCPLLVNMVEAGNKGVKSGEGFYIYSQ 272 Lambda K H 0.318 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 287 Length adjustment: 26 Effective length of query: 256 Effective length of database: 261 Effective search space: 66816 Effective search space used: 66816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory