Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate Echvi_1750 Echvi_1750 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__Cola:Echvi_1750 Length = 661 Score = 170 bits (430), Expect = 1e-46 Identities = 112/348 (32%), Positives = 168/348 (48%), Gaps = 36/348 (10%) Query: 43 LLMYRAMVVGRAFNRQATAFSRQGRLAVYPSSRGQEACQVGSALAVRPTDWLFPTYRESV 102 L Y +++ R + RQG+++ + S GQEA + + +A+R ++L P +R Sbjct: 18 LHFYEMLLMPRKIEEKMLLLLRQGKISKWFSGWGQEAISIAAVMAMREDEFLLPMHRNLG 77 Query: 103 ALLTRGIDPVQVLTLFRG---------DQHCGYDPVTEHTAPQCTPLATQCLHAAGLADA 153 RG+ ++ F+G D+ + V H + L Q A G+A A Sbjct: 78 VFTGRGLPLGKLFAQFQGKYSGFTKGRDRSFHFGSVAHHVVGMISHLGPQLAVADGIALA 137 Query: 154 ARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNNQYAISVPLAKQTAAR 213 +++ G+ L + GDGATSEGDFHEALN AAV + PV+F+V++N Y +S P A+Q + Sbjct: 138 SKLGGERKATLVFTGDGATSEGDFHEALNVAAVWQLPVIFVVEHNGYGLSTPSAEQFRFK 197 Query: 214 TLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIEAVTYRIDAHTNADDD 273 DK GYGM V++DGN+VL++Y A+ AE R P L+EA+TYR+ H + Sbjct: 198 QFIDKGPGYGMEAVKVDGNNVLELYHALSGIAEDIRHRPRPFLVEAMTYRMRGHEES-SG 256 Query: 274 TRYRPAGEADVWAAQDPVDRLERDLLAAGVLDRAAADGI---------AAAADAFAGELS 324 T+Y P + DPV E L GVLD++A I A A AF+ E Sbjct: 257 TKYVPKAYFEEGEKYDPVRNFEDYLQEIGVLDQSAKGVIEKRLSEQIEAGLASAFSAEFP 316 Query: 325 -------ARFSAPPTGDPMQMFRHVYHHLPPHLREQSERLAAELAADG 365 A P G P + PH +E+ + +DG Sbjct: 317 VAGEEELADVYCPSEGKPKE----------PHSSATTEKRLVDAISDG 354 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 661 Length adjustment: 34 Effective length of query: 334 Effective length of database: 627 Effective search space: 209418 Effective search space used: 209418 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory