Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate Echvi_3823 Echvi_3823 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit
Query= uniprot:G1UHX5 (328 letters) >FitnessBrowser__Cola:Echvi_3823 Length = 326 Score = 215 bits (548), Expect = 1e-60 Identities = 123/327 (37%), Positives = 184/327 (56%), Gaps = 7/327 (2%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE 60 M EI +AL A+ + +R D L GE++ G +++T G+ EFG +R DTP++E Sbjct: 1 MREIQFREALREAMSEEMRRDKNVFLMGEEVAEYNGAYKVTQGMLDEFGPDRVIDTPISE 60 Query: 61 SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG 120 G VG M G RP++E F+ A +Q+V+ AK+ + GA +P+ R P G Sbjct: 61 GGFAGLGVGAGMNGLRPIIEFMTFNFSLVAIDQIVNSAAKMYAMSGGAYNVPIVFRGPTG 120 Query: 121 --GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYW 178 G +G HS + E ++ TPGL VV P+ DA LL+ +I DPV+F+E + +Y Sbjct: 121 NAGQLGAT--HSSNFENWFANTPGLKVVVPSNPYDAKGLLKAAIRDDDPVIFMESELMYS 178 Query: 179 RKEALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTL 238 K + P+G A I+R G T++++G + ALEAAE A+ G + EVIDLRT+ Sbjct: 179 DKGEVPEGEYLLPIGVADIKRKGADVTIVSFGKIMKVALEAAEELAKDGIEAEVIDLRTV 238 Query: 239 MPLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVP- 297 P+D ATV SV++T R VVV EA+ + ++A I + F +L+APV RV D+P Sbjct: 239 RPIDYATVYESVKKTNRCVVVEEANPISSLATDLAFNIQKNMFDYLDAPVLRVNSMDIPL 298 Query: 298 -YPPPLLERHYLPGVDRILDAVASLEW 323 Y P +E LP V R ++AV + + Sbjct: 299 SYAPTYIEA-TLPNVKRTIEAVKQVTY 324 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 326 Length adjustment: 28 Effective length of query: 300 Effective length of database: 298 Effective search space: 89400 Effective search space used: 89400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory