Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate Echvi_0343 Echvi_0343 Enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::D3RXI0 (252 letters) >FitnessBrowser__Cola:Echvi_0343 Length = 258 Score = 106 bits (265), Expect = 4e-28 Identities = 75/259 (28%), Positives = 129/259 (49%), Gaps = 20/259 (7%) Query: 6 IKVEKDERVARIKIANPPV-NVLDMETMKEIISAIDEVEGVD---VIVFSGEGKSFSAGA 61 +K E+ R+ + ++ P N L+ + + +A+D E ++ V++ EGK F +GA Sbjct: 5 VKFEQKGRIGYVILSRPEKRNALNAAMVSGLQAALDRCEAIETVKVVIIKAEGKVFCSGA 64 Query: 62 EIKE-------HFPDKAPEMIRWFTQLIDKVLRCKAITVAAVKGFALGGGFELAIACDFV 114 ++++ F + + +L ++ + +A V+G AL GG L CDF Sbjct: 65 DLQDIERMQDNTFDENLADS-EGLKKLFLRLYTFPKVVIAQVQGHALAGGCGLVSVCDFA 123 Query: 115 LASKNAKLGVPEITLAHYPPVAIALLPRMIGWKNAYELILTGEAITAERAFEIGLVNKVF 174 A AKLG E+ + P + + L R +G A EL+LTGE + A A EIGL+ +VF Sbjct: 124 YAVPTAKLGYTEVRIGFVPAMVLVFLVRKLGEGKAKELLLTGELLVAPAAKEIGLIQEVF 183 Query: 175 EDENFEESVNDFVNSLL-EKSSVALRLTKKALLFSTE---KEYLSLFDVINDVYLSQLVK 230 E + +V + L+ + S ++ LTKK + + +E L +N ++ + Sbjct: 184 EPAALDGAVQEIAERLISQNSGESMALTKKMIAAVQDLPLEEALEYAARMN----AKARE 239 Query: 231 SEDAVEGLKAFLEKRKPEW 249 +ED G+ AFL K+K EW Sbjct: 240 TEDCKRGIAAFLGKKKIEW 258 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 258 Length adjustment: 24 Effective length of query: 228 Effective length of database: 234 Effective search space: 53352 Effective search space used: 53352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory