Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate Echvi_2481 Echvi_2481 fumarylacetoacetase
Query= BRENDA::Q94272 (418 letters) >FitnessBrowser__Cola:Echvi_2481 Length = 425 Score = 447 bits (1150), Expect = e-130 Identities = 228/420 (54%), Positives = 304/420 (72%), Gaps = 9/420 (2%) Query: 1 MKSFVSVPQNSDFPIQNLPYGVFSTKADSSRHIGVAIGDQILNLAEIANLFDGPQLKAHQ 60 +KS+V +P+NSDF I NLP+GVF K S R IG+AIGD+I++L + + + Sbjct: 9 LKSWVQIPKNSDFTIYNLPFGVFRNKRLSPR-IGMAIGDKIVDLHVLFCEGFFSSIHLPE 67 Query: 61 DVFKQSTLNAFMALPRPAWLEARARIQQLLSEDCAVLRDNAHLRSRALVAQSDATMHLPA 120 +VF + +LN FMAL +P + R +Q+LL E+ L+D+ R + +V + +A M +P Sbjct: 68 EVFLKDSLNEFMALGKPMTRKVREMVQELLLEENTALKDH-RARGKVMVNRKEAKMLMPV 126 Query: 121 QIGDYTDFYSSIHHATNVGIMFRGKENALMPNWKWLPVGYHGRASSIVVSGTDLKRPVGQ 180 ++GDYTDFYSS HATNVG MFR ENALMPNWK LPVGYHGRASSIV SGT + RP GQ Sbjct: 127 KVGDYTDFYSSKEHATNVGTMFRDPENALMPNWKHLPVGYHGRASSIVPSGTPIHRPKGQ 186 Query: 181 TKAPDAEVPSFGPSKLMDFELEMAFFVGGPENELGTRVPIEKAEDRIFGVVLMNDWSARD 240 KAPDAE PSFGPS+ +DFELEMAF P ++GT + ++AE+ IFG VL NDWSARD Sbjct: 187 FKAPDAEKPSFGPSRRLDFELEMAFITSNP-TKMGTSIRTQEAEEHIFGFVLFNDWSARD 245 Query: 241 IQAWEYVPLGPFLAKSFATTVSPWVVSIEALRPYFVENP-VQDPVPPAYLHHDDPFTLDI 299 IQAWEYVPLGPFL KSFA+++SPWVV++EAL P+ ++P ++P+ P YL + DI Sbjct: 246 IQAWEYVPLGPFLGKSFASSISPWVVTLEALAPFRTKSPKPEEPLLP-YLQCEQDHGFDI 304 Query: 300 NLAVSIRPEGDAVDHIVCKTNFKHLYWTLKQQLAHHTVNGCNLRAGDLLGSGTVSGPEEG 359 +L V I+PEG + IVC++N+K+LYW + QQLAH TVNGCN+ GD+ SGT+SGPEE Sbjct: 305 HLEVGIQPEGKQ-ETIVCRSNYKYLYWNIAQQLAHQTVNGCNINVGDMYASGTISGPEES 363 Query: 360 AYGSMLELSWRGAKEVPV--GSEIRKFLKDGDEVNLSGVCEKNGVRIGFGECRGKVLPAD 417 ++GSMLEL+W+G K + + G+E R F++DGD V + G EK+GVR+GFGE V+P++ Sbjct: 364 SFGSMLELAWKGTKPIRLDCGAE-RSFIEDGDTVTMRGYAEKDGVRVGFGEVSTAVMPSN 422 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 29 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 425 Length adjustment: 32 Effective length of query: 386 Effective length of database: 393 Effective search space: 151698 Effective search space used: 151698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Echvi_2481 Echvi_2481 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.30329.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-180 585.9 0.0 2.5e-180 585.8 0.0 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2481 Echvi_2481 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2481 Echvi_2481 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 585.8 0.0 2.5e-180 2.5e-180 1 419 [. 11 421 .. 11 422 .. 0.98 Alignments for each domain: == domain 1 score: 585.8 bits; conditional E-value: 2.5e-180 TIGR01266 1 sfvavaknsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkestlnaflal 74 s+v+++knsdf++ nlP+Gvf ++ +s+rig+aiGd+i+dl ++ g f+ ++ +evf + +ln f+al lcl|FitnessBrowser__Cola:Echvi_2481 11 SWVQIPKNSDFTIYNLPFGVFR-NKRLSPRIGMAIGDKIVDLHVLFCEGFFSS--IHLPEEVFLKDSLNEFMAL 81 8********************9.8899********************9***99..677789************* PP TIGR01266 75 grparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhatnvGilfrgkdna 148 g+p+ ++vre +q+ll e++ l+d++ r ++++++ ea+m +P+++Gdytdfyss +hatnvG +fr ++na lcl|FitnessBrowser__Cola:Echvi_2481 82 GKPMTRKVREMVQELLLEENTALKDHR-ARGKVMVNRKEAKMLMPVKVGDYTDFYSSKEHATNVGTMFRDPENA 154 **********************99976.58899***************************************** PP TIGR01266 149 llPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaffvgtenelGeavpieka 222 l+Pn+khlPvgyhGrass+v sGt+++rP+Gq ka++a++P+fgp+++ld+ele+af +++ ++G+++ + a lcl|FitnessBrowser__Cola:Echvi_2481 155 LMPNWKHLPVGYHGRASSIVPSGTPIHRPKGQFKAPDAEKPSFGPSRRLDFELEMAFITSNPTKMGTSIRTQEA 228 ************************************************************************** PP TIGR01266 223 eehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfrvaqlePeqdpkplpylredrad 296 eehifG+vl+ndwsardiqaweyvPlGPfl+ksfa+++sPwvv++eal Pfr++ P+ ++ +lpyl+ + +d lcl|FitnessBrowser__Cola:Echvi_2481 229 EEHIFGFVLFNDWSARDIQAWEYVPLGPFLGKSFASSISPWVVTLEALAPFRTK--SPKPEEPLLPYLQCE-QD 299 ******************************************************..99999*******999.89 PP TIGR01266 297 tafdielevslkteGlaeaavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllels 370 fdi+lev +++eG +++++++rsn k lyw ++qqlah +vnGcn++ Gd+++sGtisG+ee +fGs+lel+ lcl|FitnessBrowser__Cola:Echvi_2481 300 HGFDIHLEVGIQPEG-KQETIVCRSNYKYLYWNIAQQLAHQTVNGCNINVGDMYASGTISGPEESSFGSMLELA 372 99*************.899******************************************************* PP TIGR01266 371 akGkkevkladgetrkfledGdevilrgvckkeGvrvGfGecaGkvlpa 419 +kG+k+++l g +r f+edGd+v +rg ++k+GvrvGfGe v+p+ lcl|FitnessBrowser__Cola:Echvi_2481 373 WKGTKPIRLDCGAERSFIEDGDTVTMRGYAEKDGVRVGFGEVSTAVMPS 421 *******************************************999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (425 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.55 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory