Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate Echvi_2481 Echvi_2481 fumarylacetoacetase
Query= BRENDA::Q94272 (418 letters) >FitnessBrowser__Cola:Echvi_2481 Length = 425 Score = 447 bits (1150), Expect = e-130 Identities = 228/420 (54%), Positives = 304/420 (72%), Gaps = 9/420 (2%) Query: 1 MKSFVSVPQNSDFPIQNLPYGVFSTKADSSRHIGVAIGDQILNLAEIANLFDGPQLKAHQ 60 +KS+V +P+NSDF I NLP+GVF K S R IG+AIGD+I++L + + + Sbjct: 9 LKSWVQIPKNSDFTIYNLPFGVFRNKRLSPR-IGMAIGDKIVDLHVLFCEGFFSSIHLPE 67 Query: 61 DVFKQSTLNAFMALPRPAWLEARARIQQLLSEDCAVLRDNAHLRSRALVAQSDATMHLPA 120 +VF + +LN FMAL +P + R +Q+LL E+ L+D+ R + +V + +A M +P Sbjct: 68 EVFLKDSLNEFMALGKPMTRKVREMVQELLLEENTALKDH-RARGKVMVNRKEAKMLMPV 126 Query: 121 QIGDYTDFYSSIHHATNVGIMFRGKENALMPNWKWLPVGYHGRASSIVVSGTDLKRPVGQ 180 ++GDYTDFYSS HATNVG MFR ENALMPNWK LPVGYHGRASSIV SGT + RP GQ Sbjct: 127 KVGDYTDFYSSKEHATNVGTMFRDPENALMPNWKHLPVGYHGRASSIVPSGTPIHRPKGQ 186 Query: 181 TKAPDAEVPSFGPSKLMDFELEMAFFVGGPENELGTRVPIEKAEDRIFGVVLMNDWSARD 240 KAPDAE PSFGPS+ +DFELEMAF P ++GT + ++AE+ IFG VL NDWSARD Sbjct: 187 FKAPDAEKPSFGPSRRLDFELEMAFITSNP-TKMGTSIRTQEAEEHIFGFVLFNDWSARD 245 Query: 241 IQAWEYVPLGPFLAKSFATTVSPWVVSIEALRPYFVENP-VQDPVPPAYLHHDDPFTLDI 299 IQAWEYVPLGPFL KSFA+++SPWVV++EAL P+ ++P ++P+ P YL + DI Sbjct: 246 IQAWEYVPLGPFLGKSFASSISPWVVTLEALAPFRTKSPKPEEPLLP-YLQCEQDHGFDI 304 Query: 300 NLAVSIRPEGDAVDHIVCKTNFKHLYWTLKQQLAHHTVNGCNLRAGDLLGSGTVSGPEEG 359 +L V I+PEG + IVC++N+K+LYW + QQLAH TVNGCN+ GD+ SGT+SGPEE Sbjct: 305 HLEVGIQPEGKQ-ETIVCRSNYKYLYWNIAQQLAHQTVNGCNINVGDMYASGTISGPEES 363 Query: 360 AYGSMLELSWRGAKEVPV--GSEIRKFLKDGDEVNLSGVCEKNGVRIGFGECRGKVLPAD 417 ++GSMLEL+W+G K + + G+E R F++DGD V + G EK+GVR+GFGE V+P++ Sbjct: 364 SFGSMLELAWKGTKPIRLDCGAE-RSFIEDGDTVTMRGYAEKDGVRVGFGEVSTAVMPSN 422 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 29 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 425 Length adjustment: 32 Effective length of query: 386 Effective length of database: 393 Effective search space: 151698 Effective search space used: 151698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate Echvi_2481 Echvi_2481 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.15213.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-180 585.9 0.0 2.5e-180 585.8 0.0 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2481 Echvi_2481 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2481 Echvi_2481 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 585.8 0.0 2.5e-180 2.5e-180 1 419 [. 11 421 .. 11 422 .. 0.98 Alignments for each domain: == domain 1 score: 585.8 bits; conditional E-value: 2.5e-180 TIGR01266 1 sfvavaknsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkestlnaflal 74 s+v+++knsdf++ nlP+Gvf ++ +s+rig+aiGd+i+dl ++ g f+ ++ +evf + +ln f+al lcl|FitnessBrowser__Cola:Echvi_2481 11 SWVQIPKNSDFTIYNLPFGVFR-NKRLSPRIGMAIGDKIVDLHVLFCEGFFSS--IHLPEEVFLKDSLNEFMAL 81 8********************9.8899********************9***99..677789************* PP TIGR01266 75 grparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhatnvGilfrgkdna 148 g+p+ ++vre +q+ll e++ l+d++ r ++++++ ea+m +P+++Gdytdfyss +hatnvG +fr ++na lcl|FitnessBrowser__Cola:Echvi_2481 82 GKPMTRKVREMVQELLLEENTALKDHR-ARGKVMVNRKEAKMLMPVKVGDYTDFYSSKEHATNVGTMFRDPENA 154 **********************99976.58899***************************************** PP TIGR01266 149 llPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaffvgtenelGeavpieka 222 l+Pn+khlPvgyhGrass+v sGt+++rP+Gq ka++a++P+fgp+++ld+ele+af +++ ++G+++ + a lcl|FitnessBrowser__Cola:Echvi_2481 155 LMPNWKHLPVGYHGRASSIVPSGTPIHRPKGQFKAPDAEKPSFGPSRRLDFELEMAFITSNPTKMGTSIRTQEA 228 ************************************************************************** PP TIGR01266 223 eehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfrvaqlePeqdpkplpylredrad 296 eehifG+vl+ndwsardiqaweyvPlGPfl+ksfa+++sPwvv++eal Pfr++ P+ ++ +lpyl+ + +d lcl|FitnessBrowser__Cola:Echvi_2481 229 EEHIFGFVLFNDWSARDIQAWEYVPLGPFLGKSFASSISPWVVTLEALAPFRTK--SPKPEEPLLPYLQCE-QD 299 ******************************************************..99999*******999.89 PP TIGR01266 297 tafdielevslkteGlaeaavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllels 370 fdi+lev +++eG +++++++rsn k lyw ++qqlah +vnGcn++ Gd+++sGtisG+ee +fGs+lel+ lcl|FitnessBrowser__Cola:Echvi_2481 300 HGFDIHLEVGIQPEG-KQETIVCRSNYKYLYWNIAQQLAHQTVNGCNINVGDMYASGTISGPEESSFGSMLELA 372 99*************.899******************************************************* PP TIGR01266 371 akGkkevkladgetrkfledGdevilrgvckkeGvrvGfGecaGkvlpa 419 +kG+k+++l g +r f+edGd+v +rg ++k+GvrvGfGe v+p+ lcl|FitnessBrowser__Cola:Echvi_2481 373 WKGTKPIRLDCGAERSFIEDGDTVTMRGYAEKDGVRVGFGEVSTAVMPS 421 *******************************************999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (425 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory