Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate Echvi_1095 Echvi_1095 nitrate transport ATP-binding subunits C and D
Query= uniprot:D8J1T6 (255 letters) >FitnessBrowser__Cola:Echvi_1095 Length = 272 Score = 94.4 bits (233), Expect = 2e-24 Identities = 68/215 (31%), Positives = 112/215 (52%), Gaps = 20/215 (9%) Query: 16 GGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFELDGKPYSPSAPH 75 G L+ + ++I +G+ +IG +G GK+T +I GL G ++DG P + P Sbjct: 36 GDYVVLDDLNLSIRKGEFVSIIGHSGCGKSTLLTMIAGLNDISGGKIKVDGTPVIEAGPD 95 Query: 76 EVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAREEEAAIREKSQ 135 A FQ+ L ++ L+NVM+G KQ VF H + +++ + + Sbjct: 96 R------AVVFQSPSLLPWLSALDNVMIG----VKQ-----VFPHASRAQKQ----DICK 136 Query: 136 KLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGMNATEKLGLREL 195 LD VG+G + A LS G Q+R+ IARA A P+LL LDEP +++ + L+++ Sbjct: 137 YYLDKVGLGADFDKKAHSLSQGMQQRVGIARAFALKPKLLLLDEPFGMLDSLTRGELQDV 196 Query: 196 LVKI-QAEGKTILLIEHDVKLMMGLCNRITVLDYG 229 L++I Q E T + I HDV + L +R+ ++ G Sbjct: 197 LLEIWQREKITAVAITHDVDESIFLADRVIMMTSG 231 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 272 Length adjustment: 25 Effective length of query: 230 Effective length of database: 247 Effective search space: 56810 Effective search space used: 56810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory