Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= TCDB::Q93A35 (328 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 147 bits (371), Expect = 3e-40 Identities = 90/228 (39%), Positives = 135/228 (59%), Gaps = 12/228 (5%) Query: 1 MIRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTI 60 MI D + K + A ++ L I GEF GPSG GKT+TL+MI+ L+ G + Sbjct: 1 MINID-LQKSLKANGPAMDLDIKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHL 59 Query: 61 YINEKRISDY----DIHELRWDIGYVLQQIALFPHMTIEENIAIVPELKKWSKEKIHDRI 116 +N ++ D ++ R +GY+ Q +LFP+MT++ENIA K +K+K + + Sbjct: 60 SVNGEQWFDASFGKNVSPGRRKLGYLFQDYSLFPNMTVKENIAFA---LKNAKDKAY--L 114 Query: 117 TELLDSVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRL 176 ELL+S+GL + P LSGG+QQRV + RALA P I+L+DEP SALDP R++L Sbjct: 115 MELLESMGL--LHLQDTLPKHLSGGQQQRVALARALALKPDILLLDEPLSALDPSMREKL 172 Query: 177 QQDISALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQE 224 Q+ I A+ +K T + V+HD E + L DRI + G++++ TP+E Sbjct: 173 QEYILAIHRKYALTTILVSHDAGEIIKLSDRIIELDHGKVLRQCTPKE 220 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 290 Length adjustment: 27 Effective length of query: 301 Effective length of database: 263 Effective search space: 79163 Effective search space used: 79163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory