GapMind for catabolism of small carbon sources

 

Alignments for a candidate for epi in Echinicola vietnamensis KMM 6221, DSM 17526

Align Methylmalonyl-CoA epimerase; DL-methylmalonyl-CoA racemase; EC 5.1.99.1 (characterized)
to candidate Echvi_0089 Echvi_0089 methylmalonyl-CoA epimerase

Query= SwissProt::O58010
         (136 letters)



>FitnessBrowser__Cola:Echvi_0089
          Length = 134

 Score =  120 bits (302), Expect = 6e-33
 Identities = 56/129 (43%), Positives = 96/129 (74%), Gaps = 1/129 (0%)

Query: 6   KRIDHVGIAVKNLEEAIKIWEGL-GFKVEEIEEVPDQKVKVAVIKVGENRIELLEATTED 64
           ++I+H+GIAVK+L+++ +++  L G +  + E V D+ V  +  +VG+ +IELLEAT  D
Sbjct: 2   RKIEHLGIAVKDLKKSNELFSRLFGKEAYKEERVEDEGVLTSFFQVGDVKIELLEATAPD 61

Query: 65  SPIAKFIEKRGEGIHHLAIRVENIESKLEELKQKGYKLIDEKPRVGAGGAKIAFIHPKSV 124
           SPIAKFI+KR EG+HH+A  V++I ++++ LK+ G++++++ P+ GA    + F+HP+S 
Sbjct: 62  SPIAKFIDKRAEGVHHVAFAVDDIYAEMDRLKKAGFEILNDVPKKGADHKLVVFLHPRST 121

Query: 125 TGVLLELCE 133
            GVL+ELC+
Sbjct: 122 NGVLVELCQ 130


Lambda     K      H
   0.317    0.138    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 93
Number of extensions: 4
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 136
Length of database: 134
Length adjustment: 15
Effective length of query: 121
Effective length of database: 119
Effective search space:    14399
Effective search space used:    14399
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 42 (20.8 bits)

Align candidate Echvi_0089 Echvi_0089 (methylmalonyl-CoA epimerase)
to HMM TIGR03081 (mce: methylmalonyl-CoA epimerase (EC 5.1.99.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03081.hmm
# target sequence database:        /tmp/gapView.31567.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03081  [M=129]
Accession:   TIGR03081
Description: metmalonyl_epim: methylmalonyl-CoA epimerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                            -----------
      5e-45  139.4   0.3    5.6e-45  139.2   0.3    1.0  1  lcl|FitnessBrowser__Cola:Echvi_0089  Echvi_0089 methylmalonyl-CoA epi


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cola:Echvi_0089  Echvi_0089 methylmalonyl-CoA epimerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  139.2   0.3   5.6e-45   5.6e-45       1     129 []       3     130 ..       3     130 .. 0.99

  Alignments for each domain:
  == domain 1  score: 139.2 bits;  conditional E-value: 5.6e-45
                            TIGR03081   1 kldhvaiavkdleeaaklyrdvlGakvseeeelpeqgvkvvflelgetklellepleedspiakflekkkgeGl 74 
                                          k++h++iavkdl++  +l+  ++G +  +ee+++++gv + f+++g+ k+elle+++ dspiakf++k+ +eG+
  lcl|FitnessBrowser__Cola:Echvi_0089   3 KIEHLGIAVKDLKKSNELFSRLFGKEAYKEERVEDEGVLTSFFQVGDVKIELLEATAPDSPIAKFIDKR-AEGV 75 
                                          79*******************************************************************.**** PP

                            TIGR03081  75 hhialevddieaaletlkekgvrlldeepriGahGkkvaFlhPkdtgGvLielee 129
                                          hh+a++vddi a ++ lk++g ++l++ p+ Ga  k v+FlhP++t+GvL+el++
  lcl|FitnessBrowser__Cola:Echvi_0089  76 HHVAFAVDDIYAEMDRLKKAGFEILNDVPKKGADHKLVVFLHPRSTNGVLVELCQ 130
                                          *****************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (129 nodes)
Target sequences:                          1  (134 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 4.91
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory