Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate Echvi_1280 Echvi_1280 Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components
Query= uniprot:B2T9V8 (351 letters) >FitnessBrowser__Cola:Echvi_1280 Length = 318 Score = 182 bits (461), Expect = 1e-50 Identities = 108/309 (34%), Positives = 170/309 (55%), Gaps = 5/309 (1%) Query: 44 LPALALLIVIGAFISPSFLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLESTVGI 103 L AL +L ++ + +S FLT AN +V+ + + + +L++LT DLS+ S + + Sbjct: 10 LIALIILCLVLSLLSDRFLTLANGWNVMRQVSVNICISVGMTLVILTAGIDLSVGSILAL 69 Query: 104 APAVGAMLVMPAASAGFGMQWPAAAGLLAIVVVGAVIGF----INGFLVVRLRLNAFIVT 159 AV A L+ + G+ L V++G +GF NG+ + R ++ F+ T Sbjct: 70 CGAVTASLIKNGIAVE-GLNLHIGFAPLGAVILGVGLGFGLGWFNGWTITRFKVPPFVAT 128 Query: 160 LAMLIVLRGMLVGATKGGTLFDMPTSFFALATTIVLGLPLSVWLAAAAFAIAAFMLRYHR 219 LAML + RG+ + T G + + F L T LG+P+ VW+ A A+A + + + Sbjct: 129 LAMLTIARGLTMLWTGGFPINGLGEDFAFLGTGWFLGIPMPVWITAVIVALAVLLTKKTK 188 Query: 220 LGRALYAIGGNPEAARAAGIRVERITWGVFVLGSILASVGGLIVTGYVGAINANQGNGMI 279 GR +YAIGGN AAR +GI + R+ V+ + LA+VGG+IVT + + N G Sbjct: 189 FGRYVYAIGGNERAARLSGINISRVKMTVYAIAGGLAAVGGMIVTSRLDSAQPNAGISYE 248 Query: 280 FTVFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIILGSL 339 AA VIGG SL GGKGT+ GA+ G +++GV+ N L L V FW Q + GA+IL ++ Sbjct: 249 LDAIAAVVIGGTSLSGGKGTIMGAVLGGIIIGVLNNGLVLLNVSPFWQQVVKGAVILLAV 308 Query: 340 MVARLASGE 348 ++ + S E Sbjct: 309 VIDKANSKE 317 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 318 Length adjustment: 28 Effective length of query: 323 Effective length of database: 290 Effective search space: 93670 Effective search space used: 93670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory