Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate Echvi_4005 Echvi_4005 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= SwissProt::A3LZU7 (258 letters) >FitnessBrowser__Cola:Echvi_4005 Length = 262 Score = 123 bits (308), Expect = 4e-33 Identities = 83/255 (32%), Positives = 134/255 (52%), Gaps = 8/255 (3%) Query: 5 LNGKVVAITGGVTGIGRAIAIEMARNGAKVVVN-HLPSEEQAQLAKELKEEISDGENNVL 63 L+GKV +TG G+G A+A +A++GA ++VN H P A++ K L+E +DG Sbjct: 7 LSGKVALVTGATHGLGMAMAKALAKSGATLIVNGHTP----AKMEKALEEYAADGIEAHG 62 Query: 64 TIPGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGA 123 + + E ++ E+ KFG +++ V+NAG+ +E+ + VN++L Sbjct: 63 YLFDVTNEKEVDEKLSEIE-GKFGTVDILVNNAGMIQRTPAMEMEVADFAKVVNMDLVSP 121 Query: 124 FFAIQAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYG 183 F + A+ M ++G GG II I S+ + +G + Y K G+ L ++ A KY Sbjct: 122 FLMSKRVAKGMKEKG-GGKIINICSMMSELGRNTVSGYAAAKGGLKMLTRNLATEWAKYN 180 Query: 184 IRCNAILPGTISTALNEEDLKDPEK-RKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYV 242 I+ N I PG +T D ++ R P GR GDP+D+ G +FLAS SN+V Sbjct: 181 IQVNGIGPGYFATEQTAPIRVDGHPFNDFIINRTPAGRWGDPEDLQGTMVFLASQASNFV 240 Query: 243 NGAQLLVDGGLFVNL 257 NG + VDGG+ ++ Sbjct: 241 NGQIVYVDGGILASI 255 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory