Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; EC 1.1.1.401 (characterized)
to candidate Echvi_0507 Echvi_0507 Threonine dehydrogenase and related Zn-dependent dehydrogenases
Query= SwissProt::P0DOW0 (331 letters) >FitnessBrowser__Cola:Echvi_0507 Length = 337 Score = 123 bits (308), Expect = 7e-33 Identities = 92/301 (30%), Positives = 132/301 (43%), Gaps = 9/301 (2%) Query: 1 MKTLTWTAKETMSILSAPAPVPEPGWIALRVAGVGICGSELSGYLGHNELRKPPLVMGHE 60 MK LT T P PG +++ +GICG++L Y G P V+GHE Sbjct: 1 MKILTCTEPGNFEYSEGEKPTLSPGRAIIKIKRIGICGTDLHAYEGTQPFFNYPRVLGHE 60 Query: 61 FSGVVEEVGHGVTNVKIGDLVTANPLVTCGRCIHCLRGERQRCESRRIIGIDFPGAYAER 120 SG + EV G GDLVT P CG C+ C G+ C + + G+ G E Sbjct: 61 LSGELVEV-DGAEGFVPGDLVTIIPYFNCGECVACKAGKPNCCATISVFGVHEDGGMKEF 119 Query: 121 VLVPSNQCYAVK--DAIDGALVEPLACAVRAVGLARIKVGDTAVVIGAGIIGLMTVRLLG 178 + VPS+ + AL EPLA V A ++ G+ VV+GAG IGL + Sbjct: 120 ISVPSSSLVKQEGLSLEQLALAEPLAIGAHGVRRAGVQPGEFVVVMGAGPIGLGVMEFAR 179 Query: 179 LSGAKRIAVVDPNDERLKISQLWGATEMAPN----LGALLTDNHPQSF-DCVIDAVGLST 233 ++G K IA +D N++RL + E N A + D SF + VIDA G S Sbjct: 180 IAGGKVIA-MDINEDRLAFCRETLGVEYTVNAKGDFKAAIADITGGSFAESVIDATGSSV 238 Query: 234 TRRDSLNALIRGGRAVWIGLHEALTHLDGNQIVRDELEVRGSFCYTDDEFIRAVSLINSQ 293 + GGR V +GL + + + + E + S T ++F + + Q Sbjct: 239 AIHHGFGLMAHGGRYVLVGLQKGPIEFNHPEFHKRESTLMSSRNATREDFDTVLKALKEQ 298 Query: 294 K 294 K Sbjct: 299 K 299 Lambda K H 0.322 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 337 Length adjustment: 28 Effective length of query: 303 Effective length of database: 309 Effective search space: 93627 Effective search space used: 93627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory