Align RhaQ (characterized, see rationale)
to candidate Echvi_1280 Echvi_1280 Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Cola:Echvi_1280 Length = 318 Score = 151 bits (381), Expect = 2e-41 Identities = 94/304 (30%), Positives = 159/304 (52%), Gaps = 14/304 (4%) Query: 32 LFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEIDLSVAAIIA 91 L A+ +L V SL S FL N + + I+ M L++++ IDLSV +I+A Sbjct: 10 LIALIILCLVL-SLLSDRFLTLANGWNVMRQVSVNICISVGMTLVILTAGIDLSVGSILA 68 Query: 92 LASTAMGAAVQIGIGTPGL-----------VLIGIGTGLACGVFNGVLVSVLKLPSIVVT 140 L + ++ GI GL V++G+G G G FNG ++ K+P V T Sbjct: 69 LCGAVTASLIKNGIAVEGLNLHIGFAPLGAVILGVGLGFGLGWFNGWTITRFKVPPFVAT 128 Query: 141 IGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLAVLFAILLHAT 200 + +++ RG++ + G DFA+ G G+ + + ++ +++A L +L T Sbjct: 129 LAMLTIARGLTMLWTGGFPINGLGEDFAFLGTGWFLGIPMPVWITAVIVA-LAVLLTKKT 187 Query: 201 NFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRPSIAQGW 260 FGR VYAIG N+ AAR SGI + RVK ++ + G ++ + + +TSRL S +P+ + Sbjct: 188 KFGRYVYAIGGNERAARLSGINISRVKMTVYAIAGGLAAVGGMIVTSRLDSAQPNAGISY 247 Query: 261 ELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFIGLLIIV 320 EL+ + VV+GG S+ GG G V+ ++G++ GL LLN+ + G +I++ Sbjct: 248 ELDAIAAVVIGGTSLSGGKGTIMGA-VLGGIIIGVLNNGLVLLNVSPFWQQVVKGAVILL 306 Query: 321 TIAI 324 + I Sbjct: 307 AVVI 310 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 318 Length adjustment: 28 Effective length of query: 309 Effective length of database: 290 Effective search space: 89610 Effective search space used: 89610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory