Align L-rhamnose-proton symporter; L-rhamnose-H(+) transport protein (characterized)
to candidate Echvi_1690 Echvi_1690 L-rhamnose-proton symport protein (RhaT).
Query= SwissProt::P27125 (344 letters) >FitnessBrowser__Cola:Echvi_1690 Length = 344 Score = 192 bits (488), Expect = 1e-53 Identities = 104/340 (30%), Positives = 175/340 (51%), Gaps = 8/340 (2%) Query: 8 GIFWHLIGAASAACFYAPFKKVKKWSWETMWSVGGIVSWIILPWAISALLLPNFWAYYSS 67 G+ +H +GA+ AA Y P KKV WSW+T W W +LP + L +P Sbjct: 6 GVMFHAVGASFAALCYTPQKKVVSWSWQTYWLAQAFFCWFLLPIIGAWLTIPELMKVLDE 65 Query: 68 FSLSTRLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPIINGNFDV 127 F G +G+G +G+ +RY+G S+ I+IGI+ +VGTL+ P++ G Sbjct: 66 APKDAMWKAFGLGMAYGVGGTAFGIAIRYIGFSLTYAISIGISCVVGTLLPPLVKGELAA 125 Query: 128 LISTEGGRMTLLGVLVALIGVGIVTRAGQLKE---RKMGIKAE-EFNLKKGLVLAVMCGI 183 ++ EG + G+++ ++G+ + AG+ KE K+ I A+ F++ KGL L ++ G+ Sbjct: 126 VLQQEGSGWIVTGMVLGVLGIALCGLAGRYKELDLAKLEIGAQSSFSVSKGLPLCILAGV 185 Query: 184 FSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGAIINLGFCFIRLAKVKDLS 243 SA F+++ +P+ + A G + + Y+ G ++ L +C K + + Sbjct: 186 LSALYGFSIDQGQPIADVAVKYGAGD-FQSNVVYIFSNTGAFLVTLFYCLYLHRKQR--T 242 Query: 244 LKADFSLAKSLIIHNVLLSTLGGLMWYLQFFFYAWGHARIPAQYDYISWMLHMSFYVLCG 303 + AK+ + N LL+ + G+MWY QFFFY GH R+ Y + SW +HM V+ Sbjct: 243 FREFTRKAKAPLTKNYLLAIMTGMMWYSQFFFYGLGHVRM-GDYKFTSWAVHMIMLVMFS 301 Query: 304 GIVGLVLKEWNNAGRRPVTVLSLGCVVIIVAANIVGIGMA 343 + GL +KEW +A + V L L V++ A + +G A Sbjct: 302 TVAGLAMKEWTHAKGKTVYALVLALAVLLAAVLALTVGNA 341 Lambda K H 0.328 0.142 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 344 Length adjustment: 29 Effective length of query: 315 Effective length of database: 315 Effective search space: 99225 Effective search space used: 99225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory