Align L-serine dehydratase, alpha chain; SDH; EC 4.3.1.17; L-serine deaminase; L-SD (uncharacterized)
to candidate Echvi_0600 Echvi_0600 L-serine dehydratase, iron-sulfur-dependent, alpha subunit
Query= curated2:P33073 (292 letters) >FitnessBrowser__Cola:Echvi_0600 Length = 302 Score = 204 bits (519), Expect = 2e-57 Identities = 114/279 (40%), Positives = 163/279 (58%), Gaps = 3/279 (1%) Query: 10 DVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSDVTEYKMID 69 + C + + +Y V+E E +EE+I + L + VM + L + V+ MI+ Sbjct: 13 EYCEAKNVPLYAPVMEYEKDQRGKSEEQIWEGLRSAYKVMKDAVETGLKEEMVSRSGMIN 72 Query: 70 GFAKRTYEYANSGKSIVGDFLAKAMAMAFSTSEVNASMGKIVAAPTAGSSGIMPAMLVAA 129 AK+ Y + S++ + ++ A + EVN+ MG++VAAPTAG+SGI+P L Sbjct: 73 NGAKKVYHHP---LSVLSPEFQRLISRALAAKEVNSCMGRVVAAPTAGASGILPGTLYTL 129 Query: 130 TEKYNFDRTTIQNGFLTSIGIGQVITKYATFAGAEGGCQAECGSASAMAAAALVEMLGGT 189 E + + G L G+ +I + A+ AGA GGCQAE GSA+AMA+ A+V LGG Sbjct: 130 QEIHGLSDDKVLEGLLIGAGVALIIEQNASLAGAVGGCQAETGSAAAMASGAMVYCLGGN 189 Query: 190 VEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFISADLALAGVESLVPFD 249 +Q +A +ITI +LGLVCDP+AGLV+ PC RNAS A SA +ALA V ++P D Sbjct: 190 TDQVFNAVAITIQCMLGLVCDPVAGLVEIPCVVRNASAAAIANSSAQIALADVSGVIPVD 249 Query: 250 EVVIAMGEVGNSMIEALRETGLGGLAGSKTGQKIRRDFL 288 E V AMGE+G SM +ET LGGLA + TG+ I + L Sbjct: 250 ECVEAMGEIGASMENKYKETALGGLAATLTGKGIAKKVL 288 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 302 Length adjustment: 26 Effective length of query: 266 Effective length of database: 276 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Echvi_0600 Echvi_0600 (L-serine dehydratase, iron-sulfur-dependent, alpha subunit)
to HMM TIGR00718 (sdaAA: L-serine dehydratase, iron-sulfur-dependent, alpha subunit (EC 4.3.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00718.hmm # target sequence database: /tmp/gapView.18705.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00718 [M=300] Accession: TIGR00718 Description: sda_alpha: L-serine dehydratase, iron-sulfur-dependent, alpha subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-83 265.0 7.3 4.4e-83 264.8 7.3 1.0 1 lcl|FitnessBrowser__Cola:Echvi_0600 Echvi_0600 L-serine dehydratase, Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0600 Echvi_0600 L-serine dehydratase, iron-sulfur-dependent, alpha subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 264.8 7.3 4.4e-83 4.4e-83 6 287 .. 9 288 .. 4 297 .. 0.96 Alignments for each domain: == domain 1 score: 264.8 bits; conditional E-value: 4.4e-83 TIGR00718 6 kelievtkekqikisdlvleeeikvsektkeeirkkldavldvmeaavqknl.esvvsetklidGdakklqeyi 78 + e ++ k++ ++ v+e e ++ k++e+i + l + +vm+ av+ +l e vs+ ++i+ akk++++ lcl|FitnessBrowser__Cola:Echvi_0600 9 QGWKEYCEAKNVPLYAPVMEYEKDQRGKSEEQIWEGLRSAYKVMKDAVETGLkEEMVSRSGMINNGAKKVYHHP 82 556688999*******************************************9999**************9876 PP TIGR00718 79 rsGkslvGdllldavakavatsevnaamGkivaaptaGsaGvvpatlvavkeklnfdreqiirflltaiaiGfv 152 s+ + + +++a+a++evn++mG++vaaptaG++G++p+tl++ +e + +++ ++ll +++ + lcl|FitnessBrowser__Cola:Echvi_0600 83 L---SVLSPEFQRLISRALAAKEVNSCMGRVVAAPTAGASGILPGTLYTLQEIHGLSDDKVLEGLLIGAGVALI 153 5...5667788999************************************************************ PP TIGR00718 153 vakyasiaGaeGGcqaevGsasamaaaalvemlGGtveqaleaaaitlknvlGlvcdpvaGlvevpcvkrnasG 226 + ++as+aGa GGcqae Gsa+ama+ a+v lGG ++q +a+ait++ +lGlvcdpvaGlve+pcv rnas lcl|FitnessBrowser__Cola:Echvi_0600 154 IEQNASLAGAVGGCQAETGSAAAMASGAMVYCLGGNTDQVFNAVAITIQCMLGLVCDPVAGLVEIPCVVRNASA 227 ************************************************************************** PP TIGR00718 227 vinaliaadlalaGveslvpfdevviamykvGqsmiealretGlGGlaasktGrklekdil 287 ++ a +a++ala v +p+de v+am+++G sm + +et lGGlaa+ tG+ + k++l lcl|FitnessBrowser__Cola:Echvi_0600 228 AAIANSSAQIALADVSGVIPVDECVEAMGEIGASMENKYKETALGGLAATLTGKGIAKKVL 288 **********************************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.52 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory