Align serine racemase (EC 5.1.1.18) (characterized)
to candidate Echvi_1189 Echvi_1189 Threonine dehydratase
Query= BRENDA::Q2PGG3 (331 letters) >FitnessBrowser__Cola:Echvi_1189 Length = 319 Score = 267 bits (682), Expect = 3e-76 Identities = 145/314 (46%), Positives = 199/314 (63%), Gaps = 9/314 (2%) Query: 12 ILSIKEAHDRIKPYIHRTPVLTSESLNSISGRSLFFKCECLQKGGAFKFRGACNAVLSLD 71 ++ IK+A+ RI YIH TP+LT E++N ++ L+FKCE QK GAFK RGA NA+L L Sbjct: 10 LIDIKQAYQRIMAYIHHTPILTCEAINKMADCQLYFKCENFQKVGAFKARGATNAILKLP 69 Query: 72 AEQAAKGVVTHSSGNHAAALSLAAKIQGIPAYIVVPKGAPKCKVDNVIRYGGKVIWSEAT 131 GV THSSGNHAAAL+ AAK G AYIV+P A K V YGG++I E Sbjct: 70 PGLKKNGVATHSSGNHAAALARAAKETGTKAYIVMPSTAAAIKKAAVRTYGGEIIECEPN 129 Query: 132 MSSREEIASKVLQETGSVLIHPYNDGRIISGQGTIALELLEQIQEIDAIVVPISGGGLIS 191 + +RE KV++ETG+ I PY+ +I GQ T ALE+ ++ DAI+ P+ GGGL++ Sbjct: 130 LKARETTLEKVVEETGAAFIPPYDYMDVIEGQATCALEMWDEGIPFDAIITPVGGGGLLA 189 Query: 192 GVALAAKSIKPSIRIIAAEPKGADDAAQSKVAGKIITLPVTNTIADGLRASLGDLTWPVV 251 G AL + + AEPKGADDA +S A KII + NTIADGL SLG + ++ Sbjct: 190 GTALTTHYLSRKTPVYGAEPKGADDAYRSLKANKIIPMENPNTIADGLLTSLGKRNFTII 249 Query: 252 RDLVDDVVTLEECEIIEAMKMCYEILKVSVEPSGAIGLAAVLSNS--FRNNPSCRDCKNI 309 V D++T+ + +II AM++ +E +K+ +EPS A+ LAA+L+N F+N K + Sbjct: 250 SKNVADILTVSDDQIIAAMRLVFERMKLVIEPSSAVPLAAILANKPLFQN-------KRV 302 Query: 310 GIVLSGGNVDLGSL 323 GIV+SGGNVD+ L Sbjct: 303 GIVISGGNVDVSKL 316 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 319 Length adjustment: 28 Effective length of query: 303 Effective length of database: 291 Effective search space: 88173 Effective search space used: 88173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory