Align L-serine dehydratase, beta chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate Echvi_2833 Echvi_2833 L-serine dehydratase, iron-sulfur-dependent, beta subunit
Query= uniprot:P33074 (222 letters) >FitnessBrowser__Cola:Echvi_2833 Length = 225 Score = 147 bits (372), Expect = 1e-40 Identities = 69/196 (35%), Positives = 122/196 (62%), Gaps = 1/196 (0%) Query: 5 SAFEVMGPIMVGPSSSHTAGACKIANVATSIVSNNYNQVEFQLHGSFAHTFKGHGTDRAL 64 S F+++GP+M+GPSSSHTAG +IA A ++ + + SFA T++GHG+D+A+ Sbjct: 6 SVFDMIGPVMIGPSSSHTAGVVRIARAAIKVLGGIPDDAVITFYNSFARTYEGHGSDKAI 65 Query: 65 VGGILGFEPDDDRIKTSFELAKQAGLNYIFTTTNLGDNYHPNSVKIVFSYPNGEEEYVIG 124 +GG++ + DD RIK +FELA+ GL YIF + +HPN++K+ + + + E VIG Sbjct: 66 IGGLMDLKTDDARIKQAFELAEARGLTYIFKSVGNASVFHPNTIKLNLTKGDRKVE-VIG 124 Query: 125 SSIGGGAMKIVNINGIAIEFRGEYSTILLEYPEQRGVISYVSSLLTGSEYNIESLNTKKN 184 S+GGG + I +I+G EF + T++++ + G I++++S+L + NI +++ + Sbjct: 125 ESLGGGLINIKSIDGFHAEFSAQEHTLIIKADDVSGAIAFITSILAQEQANIATMSVSRK 184 Query: 185 KLTNIVTLTVEIDKPL 200 ++ +E+D L Sbjct: 185 GKRDMACHVIEMDSGL 200 Lambda K H 0.314 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 225 Length adjustment: 22 Effective length of query: 200 Effective length of database: 203 Effective search space: 40600 Effective search space used: 40600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory