Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 150 bits (380), Expect = 3e-41 Identities = 99/273 (36%), Positives = 148/273 (54%), Gaps = 24/273 (8%) Query: 21 DINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGDLTIDGMRVND------VAPAK 74 DI L I+ GEF+ GPSG GK++ +RMI+GL G L+++G + D V+P + Sbjct: 20 DIKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHLSVNGEQWFDASFGKNVSPGR 79 Query: 75 RGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRNAAKILHIDHLLDRKPKQL 134 R + +FQ Y+L+P+MT+ +N+AF LK A K A + + + + HL D PK L Sbjct: 80 RKLGYLFQDYSLFPNMTVKENIAFALKNAKDK-----AYLMELLESMGLLHLQDTLPKHL 134 Query: 135 SGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMRLEFARLHDELKTTMIYVTHDQ 194 SGGQ+QRVA+ RA+ KP + L DEPLS LD ++R K++ +H + T I V+HD Sbjct: 135 SGGQQQRVALARALALKPDILLLDEPLSALDPSMREKLQEYILAIHRKYALTTILVSHDA 194 Query: 195 VEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAGFIGSPKMNFMEGVVQSVTH--- 251 E + L+D+I+ L G + + +P + F G M+ +E V + H Sbjct: 195 GEIIKLSDRIIELDHGKVLRQCTPKEFFGTGLTSAKFQFQGE-IMDILEDDVVHIVHVKT 253 Query: 252 --DGVTVRYETGETQRVAVEPAAVKQGDKVTVG 282 D V V + ET+ + V GDKV VG Sbjct: 254 GNDLVKVVCDMDETKELGV-------GDKVLVG 279 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 290 Length adjustment: 28 Effective length of query: 341 Effective length of database: 262 Effective search space: 89342 Effective search space used: 89342 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory