Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate Echvi_4610 Echvi_4610 3-oxoacyl-(acyl-carrier-protein) reductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Cola:Echvi_4610 Length = 248 Score = 129 bits (323), Expect = 8e-35 Identities = 82/264 (31%), Positives = 135/264 (51%), Gaps = 31/264 (11%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQS--------SGNYNFWPT 58 L K +TG + GIG AI + +GANV + +K Q+ + + Sbjct: 4 LTGKTALITGASKGIGRAIALKYAQEGANVAFTFLSSVEKGQALEKELAEFGVKAKGFRS 63 Query: 59 DISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNI 118 D S + V+ +++ FG +D L+NNAGV LL+ +NE A++ ++NI Sbjct: 64 DASDFKAAEELVNEVVKEFGALDVLINNAGVTRDNLLM---------RMNEEAWDDVMNI 114 Query: 119 NQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKEL 178 N K F +A R ++KQ++G I+N++S G++G+ GQ+ YAA+KA + FT+S + EL Sbjct: 115 NLKSCFNTVKAATRTLMKQKAGSIINITSVVGIKGNAGQANYAASKAGIIGFTKSVALEL 174 Query: 179 GKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEV 238 G GIR VAPG +E + + W +++IP+ R G+ EV Sbjct: 175 GSRGIRSNAVAPGFIETEMTEVLDEKTVQGW--------------RDAIPMKRGGQPEEV 220 Query: 239 ADFVCYLLSERASYMTGVTTNIAG 262 A+ +L S+ +SY++G + G Sbjct: 221 ANACVFLGSDMSSYVSGQVIQVDG 244 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 248 Length adjustment: 24 Effective length of query: 243 Effective length of database: 224 Effective search space: 54432 Effective search space used: 54432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory