Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate Echvi_2849 Echvi_2849 fructose-bisphosphate aldolase, class II, yeast/E. coli subtype
Query= BRENDA::P0AB71 (359 letters) >FitnessBrowser__Cola:Echvi_2849 Length = 353 Score = 464 bits (1193), Expect = e-135 Identities = 223/349 (63%), Positives = 276/349 (79%), Gaps = 1/349 (0%) Query: 9 KPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASF 68 KPG+ G++++ + + AKE+ FALPAVN + T + NAVLETA KV +PVIVQFSNGGA F Sbjct: 4 KPGIKFGEELKDLLEYAKESEFALPAVNVINTSTANAVLETAKKVNSPVIVQFSNGGAQF 63 Query: 69 IAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGE 128 AGKG+ +D Q A+I GA+SGA HVH+MAE YGVPVILHTDH AKKL+PW+DG+L+AG+ Sbjct: 64 FAGKGLANDKQQ-ASIAGAVSGAMHVHKMAEAYGVPVILHTDHAAKKLIPWVDGMLEAGK 122 Query: 129 KHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDN 188 +++AA KPLFSSHM+DLSEE ++ENIE KYL K+ M LEIELG TGGEEDGVDN Sbjct: 123 EYYAAFKKPLFSSHMLDLSEEPIEENIETSVKYLAEFKKLEMALEIELGVTGGEEDGVDN 182 Query: 189 SHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEY 248 + +D+S LYTQPE+V YAY +L + S FTIAA+FGNVHGVYKPGNV L P IL++SQ+Y Sbjct: 183 TDIDSSKLYTQPEEVAYAYEKLREQSELFTIAAAFGNVHGVYKPGNVSLQPKILKNSQDY 242 Query: 249 VSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANE 308 + +K L ++FVFHGGSGS+ +EI+++ YG +KMNIDTD QWA WEGVL YYK NE Sbjct: 243 ICEKFGLSGKPVSFVFHGGSGSSVEEIREATGYGSIKMNIDTDMQWAFWEGVLKYYKENE 302 Query: 309 AYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAID 357 YLQ QLGNP+G D PNKK YDPRVWLR G+ + + RLE AF LNA+D Sbjct: 303 GYLQTQLGNPEGPDVPNKKKYDPRVWLRKGEENFVKRLEVAFDMLNAVD 351 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 353 Length adjustment: 29 Effective length of query: 330 Effective length of database: 324 Effective search space: 106920 Effective search space used: 106920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Echvi_2849 Echvi_2849 (fructose-bisphosphate aldolase, class II, yeast/E. coli subtype)
to HMM TIGR01520 (fbaA: fructose-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01520.hmm # target sequence database: /tmp/gapView.21778.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01520 [M=357] Accession: TIGR01520 Description: FruBisAldo_II_A: fructose-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-169 549.0 0.6 2.6e-169 548.8 0.6 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2849 Echvi_2849 fructose-bisphosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2849 Echvi_2849 fructose-bisphosphate aldolase, class II, yeast/E. coli subtype # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 548.8 0.6 2.6e-169 2.6e-169 5 356 .. 3 352 .. 1 353 [] 0.99 Alignments for each domain: == domain 1 score: 548.8 bits; conditional E-value: 2.6e-169 TIGR01520 5 lktgvilgedvaklfevakeekfaiPainvvssetvnaaleaardakspiilqfsnggaafiaGkGvkdeaeka 78 k+g+ ge++++l+e+ake +fa+Pa+nv+ ++t+na+le+a++++sp+i+qfsngga+f+aGkG+ +++++a lcl|FitnessBrowser__Cola:Echvi_2849 3 FKPGIKFGEELKDLLEYAKESEFALPAVNVINTSTANAVLETAKKVNSPVIVQFSNGGAQFFAGKGLANDKQQA 76 689********************************************************************999 PP TIGR01520 79 asiaGaiaaaeyvrsiaekygvpvvlhtdhCakkllpyvdglleadekyfkkegkPlfsshmldlseepieeni 152 siaGa+++a++v+++ae+ygvpv+lhtdh akkl+p+vdg+lea+++y+++ +kPlfsshmldlseepieeni lcl|FitnessBrowser__Cola:Echvi_2849 77 -SIAGAVSGAMHVHKMAEAYGVPVILHTDHAAKKLIPWVDGMLEAGKEYYAAFKKPLFSSHMLDLSEEPIEENI 149 .************************************************************************* PP TIGR01520 153 eiakkylkrmakiklileieiGitGGeedGvdneeadkeelytkPedvekvyeelskispkfsiaaafGnvhGv 226 e+++kyl k+++ leie+G+tGGeedGvdn + d+++lyt+Pe+v ++ye+l++ s f+iaaafGnvhGv lcl|FitnessBrowser__Cola:Echvi_2849 150 ETSVKYLAEFKKLEMALEIELGVTGGEEDGVDNTDIDSSKLYTQPEEVAYAYEKLREQSELFTIAAAFGNVHGV 223 ************************************************************************** PP TIGR01520 227 ykpGnvklrPdiladgqeyvaeklglkeakplsfvfhGGsGstkeeikealsyGvvkvnvdtdtqyaalegild 300 ykpGnv l+P+il+++q+y+ ek gl kp+sfvfhGGsGs++eei+ea yG +k+n+dtd+q+a++eg+l+ lcl|FitnessBrowser__Cola:Echvi_2849 224 YKPGNVSLQPKILKNSQDYICEKFGLS-GKPVSFVFHGGSGSSVEEIREATGYGSIKMNIDTDMQWAFWEGVLK 296 **************************9.9********************************************* PP TIGR01520 301 yvlknedylqsqvGnpkgeekpnkkvydPrvwlreaeksmkarvekaleelnaink 356 y+++ne ylq+q+Gnp+g+++pnkk+ydPrvwlr++e+ +r+e a++ lna+++ lcl|FitnessBrowser__Cola:Echvi_2849 297 YYKENEGYLQTQLGNPEGPDVPNKKKYDPRVWLRKGEENFVKRLEVAFDMLNAVDR 352 ****************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (357 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 10.01 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory