Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate Echvi_2777 Echvi_2777 Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__Cola:Echvi_2777 Length = 630 Score = 133 bits (335), Expect = 1e-35 Identities = 99/318 (31%), Positives = 158/318 (49%), Gaps = 32/318 (10%) Query: 7 SMHPYEEEFLGPILPSDWDVEMTPDFLDETTV-EKAKGAQVVSLFVSDKADGPVLE-ALH 64 ++HP E + ++VE+ + E + EK K ++ + + VLE A Sbjct: 240 NVHPIGVEIMKQ---EGYNVEVVSSAMSEEELCEKIKNVSIIGIRSKTQITKKVLENANR 296 Query: 65 SYGVGLLALRSAGYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHD 124 VG + G + ID+ET + GI V N P + ++ + ++ ++ L+R LH Sbjct: 297 LMAVGAFCI---GTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKTL 353 Query: 125 KVRLGDFDLDGLMGFDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQPEIVENV 184 K+ G ++ F++ GK G+IG G IG ++ + G V YD IVE + Sbjct: 354 KMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD------IVERL 407 Query: 185 ---------DLDTLITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDT 235 LD L+ DIIS+H EN ++ N+E +MK GAILVN +RG ++D Sbjct: 408 ALGNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDV 467 Query: 236 KALLEALKSGKLGGAALDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLT 295 AL +AL+SG L GAA+DV+ E KN+ +P+ ++L+G N +LT H T Sbjct: 468 PALRDALESGHLAGAAVDVFPTEP----KNND-----EPFESELIGCPNTILTPHIGGST 518 Query: 296 REAVKNIEETTVENILEW 313 EA +NI + I+E+ Sbjct: 519 LEAQENIAQFVPGKIIEY 536 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 630 Length adjustment: 33 Effective length of query: 292 Effective length of database: 597 Effective search space: 174324 Effective search space used: 174324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory