Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate Echvi_0091 Echvi_0091 glycine cleavage system T protein
Query= curated2:A6GXW3 (360 letters) >FitnessBrowser__Cola:Echvi_0091 Length = 364 Score = 486 bits (1252), Expect = e-142 Identities = 234/360 (65%), Positives = 283/360 (78%) Query: 1 MKNTALTNIHESLGAKMVPFAGYNMPVQYEGVNAEHEIVRTGVGVFDVSHMGEFFLKGEN 60 +K AL + H LG KMVPFAGY+MPV+Y EH VR GVGVFDVSHMGEF + G + Sbjct: 5 IKKIALNDKHIELGGKMVPFAGYHMPVRYSSDKEEHNTVRNGVGVFDVSHMGEFMVTGPH 64 Query: 61 ALALIQKVTSNDASKLVDGKAQYSCLPNNEGGIVDDLIIYKIADNHYMLVVNASNIEKDW 120 ALALIQKVTSNDA+KLV G+AQYSCLPN GGIVDDL++YK+ + Y+LVVNASNIEKDW Sbjct: 65 ALALIQKVTSNDAAKLVIGQAQYSCLPNETGGIVDDLLVYKMDEEKYLLVVNASNIEKDW 124 Query: 121 NWISSHNDLGVDMQNLSDSYSLLAIQGPKAAEAMQSLTSIDLVNMPYYSFQIGEFAGLKD 180 NWI+ HND+G ++N+SD SL A+QGPKA E +Q +T ++L + +Y F +GEFAG KD Sbjct: 125 NWINQHNDMGAALENISDEMSLFAVQGPKAVETLQKVTPVNLDEVKFYHFTVGEFAGKKD 184 Query: 181 VTVSATGYTGSGGFEIYFKNEDAEAIWNKIFEAGKPFGIKPIGLAARDTLRLEMGFCLYG 240 V +S TGYTG+GGFEIY KNEDA +WN IFEAG+ GIKPIGL ARDTLR+EMG+CLYG Sbjct: 185 VIISGTGYTGAGGFEIYVKNEDALDVWNAIFEAGEAAGIKPIGLGARDTLRMEMGYCLYG 244 Query: 241 NDINDTTSPLEAGLGWITKFDKEFTNSANLKKQKEEGVARKLVAFEMQERAVPRHDYEIV 300 NDI+DTTSPLEAGLGWITKF K+F NS NLKKQKEEGV RKLV F+ +++ +PR Y IV Sbjct: 245 NDIDDTTSPLEAGLGWITKFTKDFINSENLKKQKEEGVTRKLVGFKFKDKGIPRAHYPIV 304 Query: 301 DASGNVIGIVTSGTMSPSMNIGIGLGYVPTSFSTVDSDIFIRIRKNDVLAKVVKLPFYKK 360 + +G IG VTSGTMSPSMNIGIGLGYV +++ ++I I +R ++ A V KLP KK Sbjct: 305 NEAGKQIGEVTSGTMSPSMNIGIGLGYVEKAYAKPGTEIAITVRNKNLAAVVEKLPLLKK 364 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 364 Length adjustment: 29 Effective length of query: 331 Effective length of database: 335 Effective search space: 110885 Effective search space used: 110885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Echvi_0091 Echvi_0091 (glycine cleavage system T protein)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.32348.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-129 418.5 0.4 1.2e-129 418.3 0.4 1.0 1 lcl|FitnessBrowser__Cola:Echvi_0091 Echvi_0091 glycine cleavage syst Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0091 Echvi_0091 glycine cleavage system T protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.3 0.4 1.2e-129 1.2e-129 2 361 .. 6 363 .. 5 364 .] 0.97 Alignments for each domain: == domain 1 score: 418.3 bits; conditional E-value: 1.2e-129 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvda 75 k+ +L d h elggk+v+faG+++Pv+y+s +eeh+ vr+ +G+fDvshmg++ ++G+++l+++q++++nD ++ lcl|FitnessBrowser__Cola:Echvi_0091 6 KKIALNDKHIELGGKMVPFAGYHMPVRYSSDKEEHNTVRNGVGVFDVSHMGEFMVTGPHALALIQKVTSNDAAK 79 899*********************************************************************** PP TIGR00528 76 LtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGP 149 L G+aqys l n GG+vDDl+vyk e+ ++llvvna+++ekD +w+++h + ++ l+++s+e+sl a+qGP lcl|FitnessBrowser__Cola:Echvi_0091 80 LVIGQAQYSCLPNETGGIVDDLLVYKMDEE-KYLLVVNASNIEKDWNWINQHNDMGAALENISDEMSLFAVQGP 152 ***************************999.******************************************* PP TIGR00528 150 kaktiledlldkaveglkefffvqeaelalkka.liartGytGedGfeiavanekavelwkklvea...ygvkP 219 ka + l++++ +++++k + f +e+a+kk +i+ tGytG Gfei+v+ne+a ++w+++ ea g+kP lcl|FitnessBrowser__Cola:Echvi_0091 153 KAVETLQKVTPVNLDEVKFYHFT-VGEFAGKKDvIISGTGYTGAGGFEIYVKNEDALDVWNAIFEAgeaAGIKP 225 *****************977776.99**99877589***************************9987779**** PP TIGR00528 220 iGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeqkengtekklvGlemlekgi 293 iGLgarDtLr+e g +LyG+++d++++Pleaglgw+ k +dfi + l++qke+g+ +klvG+++ +kgi lcl|FitnessBrowser__Cola:Echvi_0091 226 IGLGARDTLRMEMGYCLYGNDIDDTTSPLEAGLGWITKFT---KDFINSENLKKQKEEGVTRKLVGFKFKDKGI 296 ************************************9999...9****************************** PP TIGR00528 294 arnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361 +r +++++ ++ k++G vtsGt+sP +++ i+l+yv+k ++k Gt++ + vrnk + + v k ++++ lcl|FitnessBrowser__Cola:Echvi_0091 297 PRAHYPIVN-EAGKQIGEVTSGTMSPSMNIGIGLGYVEKAYAKPGTEIAITVRNKNLAAVVEKLPLLK 363 *********.555**************************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.32 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory