Align Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 (characterized)
to candidate Echvi_2293 Echvi_2293 Zn-dependent hydrolases, including glyoxylases
Query= SwissProt::O24496 (258 letters) >FitnessBrowser__Cola:Echvi_2293 Length = 473 Score = 82.4 bits (202), Expect = 2e-20 Identities = 62/189 (32%), Positives = 90/189 (47%), Gaps = 20/189 (10%) Query: 1 MKI--FHVPCLQDNYSYLIIDESTGDAAVVDPV-DPEKVIASAEKHQAKIKFVLTTHHHW 57 MKI + CL Y+ ES G+AA++DP+ + E I A+++ A IK+V TH H Sbjct: 1 MKIEQIYTGCLAQGAYYI---ESNGEAAIIDPLREVEPYIEKAKRNDAVIKYVFETHFHA 57 Query: 58 DHAGGNEKIKQLVPDIKVYGGSLDKVKGCTDAV-DNGDKLTLGQDINILALHTPCHTKGH 116 D G++ + Q K+ G D G V ++ + T+G D+ I LHTP HT Sbjct: 58 DFVSGHKDLAQKT-GAKIVFGPTDAELGFEAIVGEDEQEFTIG-DVKIKLLHTPGHTMES 115 Query: 117 ISYYVNGKEGENPAVFTGDTLFVAGCGK-----------FFEGTAEQMYQSLCVTLAALP 165 Y ++ + G A+FTGDTLF+ G+ E A +Y SL + LP Sbjct: 116 SCYLLHDESGNAKAIFTGDTLFIGDVGRPDLAQKVAADLTQEKQAGHLYDSLRNKIMPLP 175 Query: 166 KPTQVYCGH 174 VY H Sbjct: 176 DDLVVYPAH 184 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 473 Length adjustment: 29 Effective length of query: 229 Effective length of database: 444 Effective search space: 101676 Effective search space used: 101676 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory