Align L-threonine aldolase (EC 4.1.2.5) (characterized)
to candidate Echvi_4604 Echvi_4604 Threonine aldolase
Query= BRENDA::Q9X266 (343 letters) >FitnessBrowser__Cola:Echvi_4604 Length = 335 Score = 270 bits (689), Expect = 5e-77 Identities = 144/328 (43%), Positives = 202/328 (61%), Gaps = 2/328 (0%) Query: 2 IDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMG 61 IDLRSDTVTKPTE M AM AEVGDDV GEDPT+ LE A FG EA +F PSGTM Sbjct: 3 IDLRSDTVTKPTEGMLAAMWSAEVGDDVLGEDPTVRALEIRLAAMFGMEAGMFCPSGTMS 62 Query: 62 NQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRP 121 NQ++I H + EVI DSHI+ YE G + + + G G + P+ V AI+P Sbjct: 63 NQIAIKLHAGQHKEVICHKDSHIYLYEGGGIMANAMTSVRLLEGHYGKVSPEAVEAAIQP 122 Query: 122 RNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGV 181 ++H P T+L+++ENT N+ GG V LE + I + + H + +H+DGARIFNA +ASG Sbjct: 123 DDVHAPMTTLVSLENTMNKGGGSVYRLEEVTAIQEVCQAHQLKLHLDGARIFNALVASGE 182 Query: 182 PVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGI 241 ++ D++ CLSKGL P+GSV++GD+ I +AR+ RK +GGGMRQ G +AAAGI Sbjct: 183 KAADWGNVFDTISVCLSKGLGCPMGSVLIGDKATIHQARRIRKAMGGGMRQVGFVAAAGI 242 Query: 242 IALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALR 301 A+ + RL EDH AR +A L+E + V+TN+VI+R + ++ + L Sbjct: 243 YAMEHHIGRLGEDHRRARQVADILREHPHVEEVFPVETNIVIVRLRD--ISPKEMLSKLN 300 Query: 302 NSGVLANAVSDTEIRLVTHKDVSRNDIE 329 + G+ A +R VTH D++ + ++ Sbjct: 301 DKGIKAVQFGQDMVRFVTHLDITDDHLQ 328 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 335 Length adjustment: 28 Effective length of query: 315 Effective length of database: 307 Effective search space: 96705 Effective search space used: 96705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory