Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate Echvi_4178 Echvi_4178 Aldo/keto reductases, related to diketogulonate reductase
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Cola:Echvi_4178 Length = 283 Score = 262 bits (670), Expect = 5e-75 Identities = 132/256 (51%), Positives = 182/256 (71%), Gaps = 3/256 (1%) Query: 9 VKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESG 68 +KL+NG+EMP G GVF++ + E +V AI GYR IDTA+ Y NE VG I +SG Sbjct: 4 IKLNNGLEMPLLGFGVFQIPDLKECERAVMDAINIGYRLIDTASAYMNEAAVGNAIIKSG 63 Query: 69 VAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEK 128 VAR+ELFITSK+W +D GYE+T AAF ++LERLQLDYLDLYLIH P D + +W+A+++ Sbjct: 64 VARKELFITSKLWVQDMGYESTKAAFRRTLERLQLDYLDLYLIHQPYGDVF-GSWKAMQE 122 Query: 129 LYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEA 188 LY+ GKI+AIGV+NFQ + +L ++ P +NQ+E HP Q+E D+ +Q+++ Sbjct: 123 LYQAGKIKAIGVANFQPDRVVDLTINSGFAPAINQIETHPFHQQQESHDFLIDHNVQMQS 182 Query: 189 WSPLMQGQ--LLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIF 246 W P +G+ + NEVL++I K+NKS+AQVILRW +Q V+ IPKS+ + RI EN IF Sbjct: 183 WGPFAEGKNGIFQNEVLSEIGRKYNKSIAQVILRWLIQRNVIAIPKSVHKERIEENFRIF 242 Query: 247 DFELSQEDMDKIDALN 262 DFE+S+EDM I AL+ Sbjct: 243 DFEISKEDMHSIAALD 258 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 283 Length adjustment: 26 Effective length of query: 250 Effective length of database: 257 Effective search space: 64250 Effective search space used: 64250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory