GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Echinicola vietnamensis KMM 6221, DSM 17526

Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate Echvi_1588 Echvi_1588 deoxyribose-phosphate aldolase

Query= BRENDA::Q9AIP7
         (220 letters)



>lcl|FitnessBrowser__Cola:Echvi_1588 Echvi_1588
           deoxyribose-phosphate aldolase
          Length = 221

 Score =  189 bits (480), Expect = 4e-53
 Identities = 100/211 (47%), Positives = 138/211 (65%), Gaps = 1/211 (0%)

Query: 3   INQYIDHTLLKPESRQDQIDKLIREAKTYNFASVCINPTWVSYAAKALEGTDIKVCTVIG 62
           IN Y++HT L P     Q++++I EA  Y F  VC+ P WV    + LE T I V TV+G
Sbjct: 4   INTYLEHTALNPVLTDQQVNRVIHEAMKYRFLGVCVPPFWVKKVKRELENTGITVVTVVG 63

Query: 63  FPLGATTSAVKAFETKDAISHGADEVDMVINIGQAKSG-HFAFVEEDIRAVVEASGDKLV 121
           FPLG   +  K FET+ AI +GADE+D+V ++   K+G ++  +E    + V     KL+
Sbjct: 64  FPLGYQMTETKVFETQKAIENGADEIDVVWSLSAFKAGMNWPKIELVKLSSVCHEAGKLL 123

Query: 122 KVIIETCLLTDKEKIKACQAAVAAGADFVKTSTGFSTAGARLDDVRLMRQTVGPDVGVKA 181
           KVI+ET  L   E  +AC+    AG D VKTSTGF+ +GARL++V+LMR+ +   VG+KA
Sbjct: 124 KVIVETAYLETDELRQACKICSDAGVDIVKTSTGFAPSGARLEEVKLMREFLPDQVGIKA 183

Query: 182 AGGTRSLEDAQAFIEAGATRIGTSAGVTIME 212
           +GG ++LE A+AF+ AGA RIGTSAGV IME
Sbjct: 184 SGGIKTLEQAKAFVTAGADRIGTSAGVQIME 214


Lambda     K      H
   0.316    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 176
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 220
Length of database: 221
Length adjustment: 22
Effective length of query: 198
Effective length of database: 199
Effective search space:    39402
Effective search space used:    39402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)

Align candidate Echvi_1588 Echvi_1588 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.12240.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                            -----------
      1e-75  239.9   0.2    1.1e-75  239.7   0.2    1.0  1  lcl|FitnessBrowser__Cola:Echvi_1588  Echvi_1588 deoxyribose-phosphate


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cola:Echvi_1588  Echvi_1588 deoxyribose-phosphate aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  239.7   0.2   1.1e-75   1.1e-75       2     210 ..       4     213 ..       3     214 .. 0.95

  Alignments for each domain:
  == domain 1  score: 239.7 bits;  conditional E-value: 1.1e-75
                            TIGR00126   2 lakliDhtalkadtteedietlcaeAkkykfaavcvnpsyvslAkelLkgteveictvvgFPlGasttevkllE 75 
                                          ++++++htal++  t+++++++++eA+ky+f  vcv p +v+  k++L++t +++ tvvgFPlG + te+k++E
  lcl|FitnessBrowser__Cola:Echvi_1588   4 INTYLEHTALNPVLTDQQVNRVIHEAMKYRFLGVCVPPFWVKKVKRELENTGITVVTVVGFPLGYQMTETKVFE 77 
                                          5789********************************************************************** PP

                            TIGR00126  76 akeaieeGAdEvDvviniaalkdkneevviedikavveaca..kvllKvilEtalLtdeekkkAseisieagad 147
                                          +++aie+GAdE+Dvv  ++a+k++ +   ie +k +  +c   + llKvi+Eta+L  +e+++A++i+ +ag+d
  lcl|FitnessBrowser__Cola:Echvi_1588  78 TQKAIENGADEIDVVWSLSAFKAGMNWPKIELVK-LSSVCHeaGKLLKVIVETAYLETDELRQACKICSDAGVD 150
                                          **********************998877776665.3444443489***************************** PP

                            TIGR00126 148 fvKtstgfsakgAtvedvrlmkkvvgdevgvKasGGvrtaedalalieagaerigasaavaii 210
                                           vKtstgf+  gA +e+v+lm++   d+vg+KasGG++t e+a+a++ aga+rig+sa+v+i+
  lcl|FitnessBrowser__Cola:Echvi_1588 151 IVKTSTGFAPSGARLEEVKLMREFLPDQVGIKASGGIKTLEQAKAFVTAGADRIGTSAGVQIM 213
                                          *************************************************************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (221 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 5.20
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory