Align predicted periplasmic glycoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate Echvi_2865 Echvi_2865 Predicted dehydrogenases and related proteins
Query= reanno::Btheta:351686 (491 letters) >FitnessBrowser__Cola:Echvi_2865 Length = 492 Score = 221 bits (562), Expect = 6e-62 Identities = 159/478 (33%), Positives = 231/478 (48%), Gaps = 72/478 (15%) Query: 6 RRKFLKTGAAALAGITIAPSSILG------------MSHGHVSPTDKLNLAAVGIGGMGH 53 RR FLK A AL ++I PS +L + P+D++NLA VGIG G Sbjct: 15 RRDFLKKSALALGAVSIVPSHVLFSKPEIRDKQGKLLRKASFVPSDRVNLACVGIGNRGE 74 Query: 54 ANINNVK--GTENIVALCDVDW--KYAKGVFDEFPNAKKYWDYRKMYDEMGKSIDGVIIA 109 IN + G NIV LCDVD ++ ++FP A ++ D+R+M D+ + D V++A Sbjct: 75 QVINAIDETGQANIVTLCDVDMGAEHTLPSMNKFPKATRFQDFREMLDKDSQHFDAVMVA 134 Query: 110 TADHTHAIITADAMTMGKHVYCQKPLTHSVYESRLLTKLAASTGVVTQMGNQGASGEGTD 169 T D +H +T AM GK VY +KPL + +E LL K A GVVTQMGNQG S Sbjct: 135 TPDFSHFPVTMAAMAAGKGVYVEKPLARTFHEIELLMKAAEKYGVVTQMGNQGHSEANYF 194 Query: 170 LVCEWIWNGEIGEVTKVECATDRPI----WPQGLNAPEKADRIPNTLNWDLFTGPAKLNP 225 W+ G I +VT + C + W + A+ IP+TL+WD + A+ + Sbjct: 195 QFKAWVDAGIIKDVTAITCHMNGRRRWHGWDVNMGKFPAAETIPDTLDWDTWLTTAQHHD 254 Query: 226 YNNVYHPWNWRGWWDYGTGALGDMACHILHQPFRALKLGY-----PTKVEGSSTLLLSAC 280 YN+ + WR W+D+G GALGD HI+ + L LG P K+EG + L Sbjct: 255 YNHDFINGQWRCWYDFGMGALGDWGAHIMDTFHQFLDLGLPYEVDPVKIEGHNALFY--- 311 Query: 281 APQAQHVKMIFPARDNMPKVALPEVEVHWYDG-GMMPERPKGFPEGK------------- 326 PQA + FP R M PEV V WYDG +PE P+G+ + Sbjct: 312 -PQATTLDFKFPKRGKM-----PEVNVSWYDGLDNIPEVPEGYGSSELDADIPAASNGKI 365 Query: 327 --QLMGPGGGLTIFHGTKDTLICGCYG--------EQPFLLSGRVPNAPKVCRRVTCSHE 376 + PG I +G + T G +G E+ + G++P P+ +H Sbjct: 366 QPAKLNPG---KIIYGKELTFKGGSHGSTLSIIPDEKAKAMEGKLPEVPE----SPSNHF 418 Query: 377 MDWVRACKEDKSNRVMPKADFSESGPMNEMVVMGVLAIRLQGLNKTLEWDGANMCFTN 434 +++ ACK ++ R + FS +GP++++ +G LA Q LN LE+D TN Sbjct: 419 ANFLLACKGEEKTR----SPFSIAGPLSQVFTLGTLA---QRLNAKLEFDRDKKVITN 469 Lambda K H 0.319 0.136 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 704 Number of extensions: 47 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 491 Length of database: 492 Length adjustment: 34 Effective length of query: 457 Effective length of database: 458 Effective search space: 209306 Effective search space used: 209306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory