Align gluconolactonase subunit (EC 3.1.1.17) (characterized)
to candidate Echvi_3767 Echvi_3767 Gluconolactonase
Query= metacyc::MONOMER-13276 (356 letters) >FitnessBrowser__Cola:Echvi_3767 Length = 344 Score = 204 bits (520), Expect = 2e-57 Identities = 117/300 (39%), Positives = 175/300 (58%), Gaps = 11/300 (3%) Query: 58 ILDVSTPIEVIASDIQWSEGPVWVKNGNFLLFSDPPANIMRKWTPDAGVSIFLKPSGHAE 117 ++ IE +AS W EGP+W+ G++LLFSD P N + K T + S +L SG++ Sbjct: 52 VISRDATIERMASGFDWVEGPLWIGKGDYLLFSDIPRNKVYKMTSEGDTSTYLNRSGYSG 111 Query: 118 PIPAGQFREPGSNGMKVGPDGKIWVADSGTRAIMKV----DPVTRQRSVVVDNYKGKRFN 173 REPGSN + + D ++ + G R + K+ D + +V +Y+GKR N Sbjct: 112 E--GAYSREPGSNALLLDKDNQLVLMQHGNRKVAKMKGGLDAPAPDFTSLVHDYQGKRLN 169 Query: 174 SPNDLFFSKSGAVYFTDPPYGLTNLDESDIKEMNYNGVFRLSPDGRLDLIEAGLSRPNGL 233 SPND F K G +YFTDPPYGL KE+++ G++ L +G L L+++ LSRPNG+ Sbjct: 170 SPNDGIFDKQGNLYFTDPPYGLPPRFAG--KELSFQGIYCLKTNGTLVLLDS-LSRPNGI 226 Query: 234 ALSPDETKLYVSNSDRASPNIWVYSLDSNGLPTSRTLLRNFRKEYFDQGLAGLPDGMNID 293 ALSPDE L+V+NSD + + Y L++ G +R+L + +E G GLPDGM + Sbjct: 227 ALSPDEKHLFVANSDEKNAAWFQYPLEAPGEVDTRSLFYDATEEVLPGGRNGLPDGMKVH 286 Query: 294 KQGNLFASAPGGIYIFAPDGECLGLISGNPGQPLSNCCFGEKGQTLFISASHNVVRVRTK 353 +G LFA+ P GI+IF G+ LG I + GQ SNC F + + L+++A +++RV K Sbjct: 287 PKGYLFATGPDGIWIFDLKGKVLGKI--HTGQLTSNCTFTDDYKHLYVTAHRDILRVDLK 344 Lambda K H 0.317 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 344 Length adjustment: 29 Effective length of query: 327 Effective length of database: 315 Effective search space: 103005 Effective search space used: 103005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory