Align predicted periplasmic 3-ketoglycoside hydrolase (DUF1080) (characterized)
to candidate Echvi_3969 Echvi_3969 Domain of Unknown Function (DUF1080).
Query= reanno::Btheta:351685 (290 letters) >FitnessBrowser__Cola:Echvi_3969 Length = 259 Score = 135 bits (340), Expect = 1e-36 Identities = 92/291 (31%), Positives = 142/291 (48%), Gaps = 34/291 (11%) Query: 1 MKKVFYPLACCLAAGVLVSCSGQKKAGSAQEEQSANEVAVSYSKSLKAAEMDSLQLPVDA 60 MKK L+ A ++ +C G+KK G+ + E S V S A+ ++L + Sbjct: 1 MKKT--TLSIFALATLMAACDGEKKEGAVETEVSE----VKASDVGAEAKDNTLTEDEKS 54 Query: 61 DGYITIFDGKTFNGWRGYGKDRVPSKWTIEDGCIKFNGSGGGEAQDGDGGDLIF-AHKFK 119 G+ +FDG++ GWRGY + +PS W IEDG G GG GGD+++ + +F Sbjct: 55 AGWQLLFDGRSAEGWRGYDAEELPSGWIIEDGNFIALGKGG-----DIGGDVVYGSEEFG 109 Query: 120 NFELEMEWKVSKGGNSGIFY-LAQEVTSKDKDGNDVLEPIYISAPEYQVLDNDNHPDAKL 178 FEL ++WK+++GGNSGIFY + E T E Y +APEYQV+D P Sbjct: 110 EFELMVDWKIAEGGNSGIFYHIVDESTH---------EAPYNTAPEYQVIDQIGFPQKLE 160 Query: 179 GKDNNRQSASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWT 238 + +Y P KP GEWN +I+ + + N + + + W++ W Sbjct: 161 MWQSIGADYGMY--TPDFEGAVKPAGEWNTTRIVFTEDKAEYYLNGKMTVSFDPWSEDW- 217 Query: 239 DLLQASKFSQDKWPLAFELLNNCGGENHEGFIGMQDHGDDVWFRNIRVKVL 289 + S+ KW + G GFIG+QDHG W++NI+++ L Sbjct: 218 ----EKRKSEGKWKDYPDY-----GVAKSGFIGLQDHGAKTWYKNIKIRKL 259 Lambda K H 0.315 0.135 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 259 Length adjustment: 25 Effective length of query: 265 Effective length of database: 234 Effective search space: 62010 Effective search space used: 62010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory