Align periplasmic glucoside 3-dehydrogenase (lacC subunit) (EC 1.1.99.13) (characterized)
to candidate Echvi_1438 Echvi_1438 hypothetical protein
Query= reanno::Cola:Echvi_1848 (183 letters) >FitnessBrowser__Cola:Echvi_1438 Length = 183 Score = 125 bits (315), Expect = 3e-34 Identities = 76/189 (40%), Positives = 112/189 (59%), Gaps = 15/189 (7%) Query: 3 MNRRDALKSFALMMGGTMVGANALL--TGCTPDKQIEGLDFSPEEIDFLDEIGDTIIPTT 60 MNRR+A+K L+ G + + + GCT K+ F+ E+ + IGD IIP T Sbjct: 1 MNRREAMKGVGLLFGSALSVSTLAVFQQGCTRSKEAVAGVFTDEDAQLMATIGDIIIPET 60 Query: 61 -DTPGAKAVGIGSFMVMMVKDTYWEEEQKQFIDGLNSLRKGFKEEVGKDFMDASQEERTA 119 D+PGAKAVGIG+FMV M++D Y +E+++ SL G+ E KDF S +E+ A Sbjct: 61 PDSPGAKAVGIGAFMVKMLEDCYSQEDRENV-----SLALGYFES-DKDFSALSPDEQVA 114 Query: 120 YLNKLNAAAR------EENGPKYFNMLKDLTVLGYFTSEIGATQALNYVEVPGKWEPCID 173 ++ L+ E+ + + ++K+LT+ GYF+SE GATQAL Y VPG+++ C+D Sbjct: 115 AVSDLDGQVYAKSNELEDGLVRGYKIIKELTLFGYFSSEAGATQALRYELVPGRYDGCVD 174 Query: 174 YKKGDKAHA 182 K GDKA A Sbjct: 175 LKPGDKAWA 183 Lambda K H 0.316 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 106 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 183 Length of database: 183 Length adjustment: 19 Effective length of query: 164 Effective length of database: 164 Effective search space: 26896 Effective search space used: 26896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory