Align glucose transporter, ATPase component (characterized)
to candidate Echvi_3112 Echvi_3112 ABC-type hemin transport system, ATPase component
Query= reanno::Phaeo:GFF3641 (260 letters) >FitnessBrowser__Cola:Echvi_3112 Length = 271 Score = 99.4 bits (246), Expect = 7e-26 Identities = 64/211 (30%), Positives = 111/211 (52%), Gaps = 17/211 (8%) Query: 31 VDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRVNGDKVEITNPRDARSH 90 +D V + +YPGEV+ +LG NGAGKSTL+K+LSG D G+I +N ++ PR + Sbjct: 18 LDQVDLQIYPGEVLTILGPNGAGKSTLLKLLSGENTCDTGKISINQVLLQQLKPRQLAKY 77 Query: 91 NIETIYQTLALADNLDAASNLFLGRELVTPFGLVDD--SAMEAECRKIMNRLNPNFQKFS 148 A+ + + + E++ L D S+ + ++M+ + Sbjct: 78 R--------AVMPQHSSVNFPYTVEEIIALGKLAHDPHSSSDQLMEEVMD-ITGTAALRE 128 Query: 149 EPVSALSGGQRQSVAIARAVYF------NAKILIMDEPTAALGPHETQMVAELIQQLKAQ 202 + LSGG+RQ V +ARA+ A+ L++DEPT+++ + V L++ L+ + Sbjct: 129 RMIKGLSGGERQRVHLARALLQIWEDKPYARYLLLDEPTSSMDIAQQHQVLRLLRFLRQR 188 Query: 203 GIGIFLIDHDVNAVMELCDRASVMKNGQLVG 233 IG+ I HD+N + D+ +MK+G++VG Sbjct: 189 NIGVLTILHDLNLAAQYSDKVMLMKDGKVVG 219 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 271 Length adjustment: 25 Effective length of query: 235 Effective length of database: 246 Effective search space: 57810 Effective search space used: 57810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory