Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate Echvi_1022 Echvi_1022 ABC-type spermidine/putrescine transport systems, ATPase components
Query= SwissProt::Q9YGA6 (372 letters) >FitnessBrowser__Cola:Echvi_1022 Length = 345 Score = 178 bits (452), Expect = 2e-49 Identities = 89/244 (36%), Positives = 152/244 (62%), Gaps = 15/244 (6%) Query: 18 AVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVP 77 AV+++ +E+++G ++G +G GKTT L++IAGLE P +G+I + + + + + P Sbjct: 20 AVKDIHMEIEEGSVQAIVGENGSGKTTLLKLIAGLEHPDKGEIVFSGQTIVNGKSAL--P 77 Query: 78 PKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVA----ELLGLTELL 133 R++ ++FQ YAL+P MT+ +N+ R+ QE + R++A L GL + Sbjct: 78 ANQREVGVIFQEYALFPQMTLLENV------REALHQE-SRNARQIAMDSLALAGLEDSF 130 Query: 134 NRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTT 193 + P +LS GQRQR AL RA+ +P++ L+D+P +LD + + + +++ + + G+T Sbjct: 131 SAYPHQLSSGQRQRAALARALASRPKLLLLDDPFRSLDTRFKNEISEDIRDIVKATGITA 190 Query: 194 IYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFIGSPPMNFLDAIVT 253 I +H +A+++ D IA++++G+LQQVG+P E+Y KPAN +VA F G N L A T Sbjct: 191 IVASHHAKDALSLADSIAILHKGILQQVGTPVEIYKKPANAYVANFFGK--RNELLATPT 248 Query: 254 EDGF 257 EDGF Sbjct: 249 EDGF 252 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 345 Length adjustment: 29 Effective length of query: 343 Effective length of database: 316 Effective search space: 108388 Effective search space used: 108388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory