Align trehalose-6-P hydrolase (TreA;BlTreA;BLi00797;BL03069) (EC 3.2.1.93) (characterized)
to candidate Echvi_2850 Echvi_2850 Glycosidases
Query= CAZy::AAU39732.1 (562 letters) >FitnessBrowser__Cola:Echvi_2850 Length = 519 Score = 243 bits (621), Expect = 1e-68 Identities = 172/542 (31%), Positives = 251/542 (46%), Gaps = 90/542 (16%) Query: 5 ENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDN 64 +N W + + Y+I+ +SF DT G+G+GDI G+ +KLD+++EL + IW P+ SP Sbjct: 31 KNYWPEAGITYEIFIQSFYDTDGDGIGDINGVTKKLDHVQELGANAIWFMPLMPSPSYHK 90 Query: 65 GYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENL 124 YD++DY +IH +YGTM DF+++L+EAHKR IKV++D+++NHTS EH WF+EA G++N Sbjct: 91 -YDVTDYKAIHPDYGTMDDFKQMLDEAHKRDIKVVIDMIINHTSDEHPWFQEAKKGRDNP 149 Query: 125 YRDFYIWK---------DMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLN 175 YRD+Y+W D K N W + YY + DLN Sbjct: 150 YRDYYVWAQYDTIQDYLDKKVVTLDSDNIRQ------WHDPGQGDDYYYGFFTGDMPDLN 203 Query: 176 WENEAVRKKVYEMMHFWF-EKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHE 234 ++N VR+++YE+ +W E G+DGFRLD I +PDD D F+ E Sbjct: 204 FDNPKVREEIYEIGRYWLAEVGVDGFRLDAAKHI-----YPDDRAADSHEFW------EE 252 Query: 235 FLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNF---HHLKADYPNGE 291 F EM + K D VGE + D P L +FNF + L Y + Sbjct: 253 FRAEMEK---VKPDVYLVGE-----VYDMKEVVAPYLTGLRALFNFDFHYTLLEAYKKED 304 Query: 292 KWALA--DFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAK 349 LA D L +++ +A NHDQPR+++ G K++ Sbjct: 305 GMLLAKKQHDILAFYNGITD--------DFIDATISSNHDQPRLLNELGKSKDKLKQAIA 356 Query: 350 MLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEIL 409 +L T + G PYIY GEE+GM K D ++ + A + E I Sbjct: 357 ILMT----MPGAPYIYYGEEIGMLGKKPD--------PNIREPFLWDVAEQDEGRTKWIT 404 Query: 410 KAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNEL 469 A S DN+ TP+ E D DS F HYK++ +L Sbjct: 405 PAFSTDNTVTPLAIQKE----------------------------DADSYFNHYKRVIQL 436 Query: 470 RKEFDIITTGDYQLILED-DQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYD 528 R + G +L E + + AY R +++L V +N K E LP D E Y Sbjct: 437 RNTHPALAIGSLELPAEKYPKAVMAYQRKTGEQELYVFHNLGKKSVEIPLPQGFDREVYH 496 Query: 529 AK 530 K Sbjct: 497 LK 498 Lambda K H 0.317 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 983 Number of extensions: 55 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 562 Length of database: 519 Length adjustment: 35 Effective length of query: 527 Effective length of database: 484 Effective search space: 255068 Effective search space used: 255068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory