GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdA in Echinicola vietnamensis KMM 6221, DSM 17526

Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate Echvi_1221 Echvi_1221 pyruvate dehydrogenase E1 component, alpha subunit

Query= metacyc::MONOMER-11683
         (330 letters)



>lcl|FitnessBrowser__Cola:Echvi_1221 Echvi_1221 pyruvate
           dehydrogenase E1 component, alpha subunit
          Length = 340

 Score =  156 bits (395), Expect = 6e-43
 Identities = 107/311 (34%), Positives = 156/311 (50%), Gaps = 6/311 (1%)

Query: 20  YRTMLLARKIDERMWLLNRSGKIP-FVISCQGQEAAQVGAAFALDREMDYVLPYYRDMGV 78
           Y +MLL R+ +E+   L    KI  F     GQEA   GA  AL+++ D  +  YRD   
Sbjct: 24  YESMLLMRRFEEKAGQLYGQQKIRGFCHLYIGQEACAAGAITALEKD-DKWITAYRDHAH 82

Query: 79  VLAFGMTAKDLMMSGFAKAADPNSG-GRQMPGHFGQKKNRIVTGSSPVTTQVPHAVGIAL 137
            L  G     +M   F KA     G G  M  H   K+   + G   V  QVP  +GI  
Sbjct: 83  PLGLGTDPGAVMAELFGKATGTTKGKGGSM--HIFDKERNFMGGHGIVGAQVPMGLGIGF 140

Query: 138 AGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAISVPYDKQVAC 197
           A + +          G+G+  QG  HE  N A ++K+PVIF+ ENN YA+     +    
Sbjct: 141 AEKYKGTKNLCICHMGDGAVRQGAVHESFNLAMLYKVPVIFVIENNGYAMGTSVKRSSNV 200

Query: 198 ENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYRLTPHSSDDD 257
           +++S     Y MP   V+G +  EV++AV EA ERAR+G+GPTL+E  +YR   HS   D
Sbjct: 201 DDLSTLGESYDMPSFAVDGMNVEEVHEAVAEAAERARKGDGPTLLEVRTYRYKGHSM-SD 259

Query: 258 DSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVNEATDEAENAPY 317
              YR REEVEE K  DP+   +  + +  +LS++  + +  ++   V +A   AE +P+
Sbjct: 260 PQKYRTREEVEEYKAKDPIEQVKKTILDNKILSEDDIKEIDAKVKKQVADAVKFAEESPW 319

Query: 318 AAPESALDYVY 328
              + A + VY
Sbjct: 320 PDGQKAFEDVY 330


Lambda     K      H
   0.316    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 268
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 330
Length of database: 340
Length adjustment: 28
Effective length of query: 302
Effective length of database: 312
Effective search space:    94224
Effective search space used:    94224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory