Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 143 bits (360), Expect = 7e-39 Identities = 85/217 (39%), Positives = 129/217 (59%), Gaps = 13/217 (5%) Query: 14 AGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDL-- 71 A GP + + L I GEF+ L GPSG GK++ LRMI+GL G L + G D Sbjct: 12 ANGPAMDLDIKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHLSVNGEQWFDASF 71 Query: 72 -----PARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEA 126 P R R + +FQ+Y+L+P+M+V +NIAF L+ K A ++ + E LL+L+ Sbjct: 72 GKNVSPGR-RKLGYLFQDYSLFPNMTVKENIAFALKNAKDKAYLME--LLESMGLLHLQD 128 Query: 127 LLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRT 186 L P+ +SGGQQQR A+ARA+ P + L DEPLS LD +R +L+ I +H++ Sbjct: 129 TL---PKHLSGGQQQRVALARALALKPDILLLDEPLSALDPSMREKLQEYILAIHRKYAL 185 Query: 187 TTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELY 223 TT+ V+HD E + L+DR+I + G++++ +P E + Sbjct: 186 TTILVSHDAGEIIKLSDRIIELDHGKVLRQCTPKEFF 222 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 290 Length adjustment: 29 Effective length of query: 377 Effective length of database: 261 Effective search space: 98397 Effective search space used: 98397 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory