Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate Echvi_1276 Echvi_1276 Dihydrodipicolinate synthase/N-acetylneuraminate lyase
Query= SwissProt::P75682 (302 letters) >FitnessBrowser__Cola:Echvi_1276 Length = 308 Score = 158 bits (399), Expect = 2e-43 Identities = 100/298 (33%), Positives = 162/298 (54%), Gaps = 10/298 (3%) Query: 7 FTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIAR 66 F GI+PP+ T + QLD PG LI+ +I GV GLF LG+ GE + L + R + + Sbjct: 11 FRGIVPPMITPLADENQLDIPGLERLINHIIAGGVHGLFILGTTGESTSLSYDIRHELVK 70 Query: 67 FAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQ 126 V+ RVPVL+G T A E++ L+ A + GA +V PYY+ + + LI Y+E Sbjct: 71 RTCAIVNGRVPVLVGITDTAATESLRLADTAAKEGAAAVVAAPPYYFSLGQPELIEYYEY 130 Query: 127 VADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGA 186 + + ++LP+ LYN P+ T + P VKTL+ NI+G+KD+ + A+ ++ +K Sbjct: 131 LVERLSLPLFLYNMPSHTKIVIEPDTVKTLS-QYDNIVGLKDSSANNAYFNKVMAKMKD- 188 Query: 187 HPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLL 246 F++ G ++ + T+LLG G ++ N P++ V L A GD+ H ++ Sbjct: 189 RQDFSLFVGPEEIMAETVLLGAHGGVNGGANMFPELYVKLYAAAESGDLETVKRLHAIVM 248 Query: 247 QI-PQMY---QLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLK 300 QI +MY Q + ++ IK A+ L G + + + ASPL R+ + + L +QLK Sbjct: 249 QISTKMYSLGQFGSSYLKGIKGALSLLG--ICSDYM--ASPLHRFREKEREILAEQLK 302 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 308 Length adjustment: 27 Effective length of query: 275 Effective length of database: 281 Effective search space: 77275 Effective search space used: 77275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory