Align D-xylonate dehydratase subunit (EC 4.2.1.25; EC 4.2.1.82) (characterized)
to candidate Echvi_3769 Echvi_3769 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily
Query= metacyc::MONOMER-18070 (393 letters) >FitnessBrowser__Cola:Echvi_3769 Length = 386 Score = 178 bits (452), Expect = 2e-49 Identities = 116/362 (32%), Positives = 185/362 (51%), Gaps = 15/362 (4%) Query: 26 VLVRVTTNDGRVGWGETVSALRAEAVANFVKKINTVLKGNDVFNVEKNRLEWYKHDFNMT 85 + V++TT G VGWGE V +A+ VA V+++ L G +E Y+ F Sbjct: 20 LFVKITTKSGLVGWGEPVIEGKADTVAACVREMEQYLIGRGAHEIEDIWQVLYRGGFYRG 79 Query: 86 ISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGKTRDKVLVYANGWYQNCVKPEDFAEK 145 + +A S +D A WDI GK L P+Y+LLGG R K+ +Y W PE E+ Sbjct: 80 GPI-LMSALSGIDQALWDIKGKHLNVPVYELLGGAVRQKMKMYC--WIGGD-HPEVVLEQ 135 Query: 146 AKEIVKMGYKALKFDPFGPYFNDISKKGLDIAEERVKAVREAVGDNVDILIEHHGRFNAN 205 A+E V GY A+K + G S K + E +K +R+ GD++D+ ++ HGR + Sbjct: 136 AQEKVDAGYTAVKMNATGEMDWVSSVKEVKKVVENIKLIRQHFGDSLDVGLDFHGRVHKP 195 Query: 206 SAIMIAKRLEKYNPLFMEEPIHPEDVEGLRKYRNNTSLRIALGERIINKQQALYFMKEGL 265 + L ++PLF+EEP+ E+ + L +++ IA GER+ ++ + +G+ Sbjct: 196 MVKRLIDELSPFDPLFIEEPVLAENNDALGHIYRYSAIPIATGERMFSRWDFKEILHQGV 255 Query: 266 VDFLQADLYRIGGVTETKKVVGIAETFDVQMAFHNAQGPILNAVTLQFDAFIPNFLIQES 325 VD +Q DL GG++E +++ +AE +D+ +A H GPI A L D N IQES Sbjct: 256 VDIIQPDLSHAGGISEVRRIATMAEAYDITIAPHCPLGPISLASALHVDFVSANAFIQES 315 Query: 326 F--------YDWFPSWKRELIYNGTPIDNGYAIIPERPGLGVEVNEKMLDSLKVKGEEYF 377 +D K +++ + GY + +RPGLGVE++E+ L + G + Sbjct: 316 SLGIHYNQGFDLLDYVKNPEVFD---LKEGYIDLFDRPGLGVEMDEERLKEGQKIGHHWA 372 Query: 378 NP 379 NP Sbjct: 373 NP 374 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 386 Length adjustment: 30 Effective length of query: 363 Effective length of database: 356 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory