Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate Echvi_3928 Echvi_3928 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= BRENDA::B8H1Z0 (248 letters) >FitnessBrowser__Cola:Echvi_3928 Length = 252 Score = 121 bits (304), Expect = 1e-32 Identities = 90/247 (36%), Positives = 123/247 (49%), Gaps = 16/247 (6%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRCD 68 L GK V+TGG SGIG +GA+VI + E AEL + I D Sbjct: 4 LNGKVAVVTGGNSGIGYSTAKKLKEEGAQVIITGRSAEKVNVAAAELGVTGIT-----AD 58 Query: 69 LMNLEAIKA----VFAEIGDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHMLFCTQ 124 ++ L AI A V A+ G VD+L NAG + T +D+++++NL+ +F + Sbjct: 59 VLELAAIDAAVNQVKADFGHVDILFVNAGIFLPAPIGQTTEDLFDQQMDINLKGAVFTIE 118 Query: 125 AVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRVTCV 184 P +K GG++IN SI+ + G+ + +Y +KA + TR A EL P IRV V Sbjct: 119 KFLPILKD--GGSIINLSSINAYTGMPNTSIYGASKAALNSYTRTAATELAPRKIRVNAV 176 Query: 185 VPGNVKTKRQEKWYTPEGEAQIVAAQC-----LKGRIVPENVAALVLFLASDDASLCTGH 239 PG V T K E + +AA LK PE++A LV FLASD AS TG Sbjct: 177 NPGPVYTPIFSKTGMSEDQLNGMAAAMQNRIPLKRYGKPEDIAELVAFLASDRASFITGA 236 Query: 240 EYWIDAG 246 EY ID G Sbjct: 237 EYNIDGG 243 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 252 Length adjustment: 24 Effective length of query: 224 Effective length of database: 228 Effective search space: 51072 Effective search space used: 51072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory