Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate Echvi_4178 Echvi_4178 Aldo/keto reductases, related to diketogulonate reductase
Query= BRENDA::A9QVV8 (324 letters) >FitnessBrowser__Cola:Echvi_4178 Length = 283 Score = 187 bits (476), Expect = 2e-52 Identities = 114/300 (38%), Positives = 167/300 (55%), Gaps = 44/300 (14%) Query: 10 IKLNSGYEMPLVGFGCWKVTNATAADQ-IYNAIKTGYRLFDGAEDYGNEKEVGEGINRAI 68 IKLN+G EMPL+GFG +++ + ++ + +AI GYRL D A Y NE VG I I Sbjct: 4 IKLNNGLEMPLLGFGVFQIPDLKECERAVMDAINIGYRLIDTASAYMNEAAVGNAI---I 60 Query: 69 KDGLVKREELFITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPIAFKFVPIEE 128 K G V R+ELFITSKLW ++ + A +TL L LDY+DL+LIH P Sbjct: 61 KSG-VARKELFITSKLWVQDMGYESTKAAFRRTLERLQLDYLDLYLIHQP---------- 109 Query: 129 KYPPGFYCGDGDNFHYEDVPLLDTWKALEKLVEAGKIKSIGISNFTGALIYDLIRGATIK 188 Y DV +WKA+++L +AGKIK+IG++NF + DL + Sbjct: 110 ---------------YGDV--FGSWKAMQELYQAGKIKAIGVANFQPDRVVDLTINSGFA 152 Query: 189 PAVLQIEHHPYLQQPKLIEYVQKAGIAITGYSSFGPQSFLELESKRALNTPTLFEHETIK 248 PA+ QIE HP+ QQ + +++ + + + F E K + F++E + Sbjct: 153 PAINQIETHPFHQQQESHDFLIDHNVQMQSWGPFA-------EGKNGI-----FQNEVLS 200 Query: 249 SIADKHGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDIG 308 I K+ KS AQV+LRW QRN+ IPKS + ER+ +N + DF+++K+D+ +IA LD G Sbjct: 201 EIGRKYNKSIAQVILRWLIQRNVIAIPKSVHKERIEENFRIFDFEISKEDMHSIAALDTG 260 Lambda K H 0.318 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 283 Length adjustment: 27 Effective length of query: 297 Effective length of database: 256 Effective search space: 76032 Effective search space used: 76032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory