GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Cupriavidus basilensis 4G11

Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate RR42_RS22745 RR42_RS22745 phosphoribosylglycinamide formyltransferase

Query= SwissProt::P33221
         (392 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS22745 RR42_RS22745
           phosphoribosylglycinamide formyltransferase
          Length = 386

 Score =  401 bits (1030), Expect = e-116
 Identities = 225/382 (58%), Positives = 265/382 (69%), Gaps = 9/382 (2%)

Query: 16  MLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEK 75
           MLLGSGELGKEV I  QRLGVE IAVDRYADAP   VAH +  I+M D D L+ ++E EK
Sbjct: 1   MLLGSGELGKEVLIALQRLGVETIAVDRYADAPGQQVAHHARTISMSDPDQLKALIEAEK 60

Query: 76  PHYIVPEIEAIATDMLIQLEEEGL-NVVPCARATKLTMNREGIRRLAAEELQLPTSTYRF 134
           P  +VPEIEAIAT ML  LE  G+  V+P ARA +LTM+REGIRRLAAE L +PTS Y+F
Sbjct: 61  PDLVVPEIEAIATQMLETLEAAGVVRVIPTARAARLTMDREGIRRLAAETLGVPTSPYKF 120

Query: 135 ADSESLFREAV-ADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQQGGRAGAGRVI 193
            DS    + A+   IGYPC+VKPVMSSSGKGQ+ I     +  AW YA  GGR   GRVI
Sbjct: 121 CDSLEELQAAIDGGIGYPCVVKPVMSSSGKGQSKIDGPADVKAAWDYAMAGGRVSHGRVI 180

Query: 194 VEGVVKFDFEITLLTVSAV--DG---VHFCAPVGHRQEDGDYRESWQPQQMSPLALERAQ 248
           VEG + FD+EITLLTV A+  DG     FC P+GH Q  GDY ESWQP  M P AL+++Q
Sbjct: 181 VEGFIDFDYEITLLTVRAIGADGQVETQFCEPIGHVQVSGDYVESWQPHPMHPAALQKSQ 240

Query: 249 EIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFALHVRAFL 308
           +IA+ V   LGG GLFGVELFV G++V FSEVSPRPHDTGMVT+I+Q  +EF LH RA L
Sbjct: 241 QIAQAVTANLGGQGLFGVELFVKGEQVWFSEVSPRPHDTGMVTMITQWQNEFELHARAIL 300

Query: 309 GLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGA-DLQIRLFGKPEIDGSRRLGVA 367
           GLPV    +  P ASAVI   + ++ V FD V  A+     ++RLFGKPE    RR+GVA
Sbjct: 301 GLPVSTALK-SPGASAVIYGGVDAKGVVFDGVDEALRVPQTELRLFGKPESFTKRRMGVA 359

Query: 368 LATAESVVDAIERAKHAAGQVK 389
           LA    V  A  RAK AAG+VK
Sbjct: 360 LAYDADVEAARVRAKDAAGRVK 381


Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 442
Number of extensions: 24
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 392
Length of database: 386
Length adjustment: 30
Effective length of query: 362
Effective length of database: 356
Effective search space:   128872
Effective search space used:   128872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory