Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate RR42_RS23710 RR42_RS23710 enoyl-CoA hydratase
Query= metacyc::MONOMER-18320 (256 letters) >FitnessBrowser__Cup4G11:RR42_RS23710 Length = 249 Score = 100 bits (250), Expect = 2e-26 Identities = 78/251 (31%), Positives = 116/251 (46%), Gaps = 12/251 (4%) Query: 13 KVATITLNVPNS-NWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCDGVDVA--- 68 +VA I LN P N L +M + AL+ ++D + +V DKAF G D+A Sbjct: 4 RVAVIRLNRPRQMNALNDALMDALGLALLACEQDDGVGAIVIT-GNDKAFAAGADIAAMR 62 Query: 69 --DHVPEKVDEMIDLFHGMFRNMAAMDVTSVCLVNGRSLGGGCELMAFCDIVIASEKAKI 126 D++ I RN+ + +V G +LGGGCEL CDI+IA++ A Sbjct: 63 GWDYMDVFKSNYITRNWETLRNVRKPVIAAVA---GYALGGGCELAMACDILIAADNAVF 119 Query: 127 GQPEINLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGLVNVVLPVEGFRE 185 G PE+ LAV P P+ + KAM++ +T + + A EAE GLV+ V+ + Sbjct: 120 GLPELKLAVIPGAGGTQRLPRAISKAKAMDMCMTARNMDADEAERSGLVSRVVAAGRLMD 179 Query: 186 AAQKFMADFTSKSRPVAMWARRAIMAGLNLDFLQALKASEIIYMQGCMATEDANEGLASF 245 A S P M + AI + + E + ATED EG+ +F Sbjct: 180 EAMAVAQTIAGFSLPSMMAVKEAINRACESSLSEGM-LFERRQLHALFATEDLKEGMNAF 238 Query: 246 LEKRKPVFKDK 256 LE+R VF+ + Sbjct: 239 LERRAAVFRHR 249 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 249 Length adjustment: 24 Effective length of query: 232 Effective length of database: 225 Effective search space: 52200 Effective search space used: 52200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory